KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0417Help
Entry
ECH74115_0417     CDS       T00778                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecf00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ecf00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ecf00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(423606..426680)
Genome map
AA seq 1024 aa AA seqDB search
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ
FVWFPAPEAVPESWLECDLPDADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENP
TGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLLSEFDLSAFLRA
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATLFNDDFSRAV
LEAEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLGLNVENPK
LWSAEIPNIYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH
HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD
PSRPVQYEGGGADTSATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGEMRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDLVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGRTIEVTSEYLFHHSDNELLHWTVALD
GKPLASGEVPLDVAPQGKQVIELPELPRLESTGQLWLTVHVVQPNATAWSEAGHISAWQQ
WRLAENLSVTLPSAPHAIPQLTTSETDFCIELDNKRWQFNRQSGFLSQMWIGDKKQLLTP
LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTV
HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLTCQLAQVAERVNWLG
LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI
SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLV
WCQK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgactatgattacagattcactggccgtcgtattacaacgtcgtgactgggaaaaccct
ggcgttacccaacttaatcgccttgcagcacatccccctttcgccagctggcgtaatagc
gaagaggcccgcaccaatcgcccttcccagcagttgcgcagcctgaatggtgagtggcaa
tttgtctggtttccggcaccagaagcggttccggaaagctggctggagtgcgatcttcct
gacgccgatactgtcgtcgtcccctcaaactggcagatgcacggttacgacgcgcccatc
tacaccaacgtgacatatcccattacggtcaatccgccatttgttcccacggagaatccg
acgggttgttactcgctcacatttaatgttgatgaaagctggctacaggaaggccagacg
cgaattatttttgatggcgttaactcggcgtttcatctgtggtgcaacgggcgctgggtc
ggttacggccaggacagtcgtttgctgtctgaatttgacctgagcgcatttttacgcgcc
ggagaaaaccgcctcgcggtgatggtgctgcgctggagtgacggcagttatctggaagat
caggatatgtggcggatgagcggcattttccgtgacgtctcgttgctgcacaaaccgacc
acacaaatcagcgatttccatgttgccactctctttaatgatgattttagccgcgcggta
ctggaggcagaagttcagatgtacggcgagctgcgcgatgagctgcgggtgacggtttct
ttgtggcagggtgaaacgcaggtcgccagcggcaccgcgcctttcggcggtgaaattatc
gatgagcgtggcggttatgccgatcgcgtcacactaggtctgaacgtcgaaaacccgaaa
ctgtggagcgccgaaatcccgaatatctatcgtgcggtggttgaactgcacaccgccgac
ggcacgctgattgaagcagaagcctgcgatgtcggtttccgcgaggtgcggattgaaaat
ggtctgctgctgctgaacggcaagccgttgctgattcgcggcgttaaccgtcacgagcat
catcctctgcatggtcaggtcatggatgagcagacgatggtgcaggatatcctgctaatg
aagcagaacaactttaacgccgtgcgctgttcgcattatccgaaccatccgctgtggtac
accctgtgcgaccgctacggcctgtatgtggtggatgaagccaatattgaaacccacggc
atggtgccaatgaatcgtctgaccgatgatccgcgctggttaccggccatgagcgaacga
gtaacacgaatggtgcagcgcgatcgtaatcacccgagtgtgatcatctggtcgctgggg
aatgagtcaggccacggcgctaatcacgacgcactctatcgctggattaaatctgtcgat
ccatcccgcccggtgcagtatgaaggcggcggagccgacacctccgcaaccgatattatt
tgcccgatgtacgcgcgcgtggatgaagaccagcccttcccggctgtgccgaaatggtcc
atcaaaaaatggctttcgctgcctggagaaatgcgcccactgatcctttgcgaatacgcc
cacgcgatgggtaacagtcttggcggcttcgctaaatactggcaggcgtttcgtcagtac
ccccgtttacagggcggcttcgtctgggacttggtggatcagtcgctgattaaatatgat
gaaaatggcaatccgtggtcggcttacggcggtgattttggcgatacgccgaatgatcgc
cagttctgcatgaacggtctggtctttgccgaccgcacgccgcatccggcgctgacggaa
gcaaaacaccagcagcagtttttccagttccgtttatccgggcgaaccatcgaagtgacc
agcgaatacctgttccatcatagcgataacgagctcctgcactggacggtggcgctggat
ggtaagccgctggcaagcggtgaagtgcctctggatgtcgctccgcaaggtaaacaggta
attgaattgcctgaactaccgcgactggagagcaccgggcaactctggctaacggtacac
gtagtgcaaccgaacgcgaccgcatggtcagaagccggacacatcagcgcctggcagcag
tggcgtctggcggaaaacctcagcgtgacactcccctccgcgccccacgccatcccgcaa
ctgaccaccagcgaaacggatttttgcatcgagctggataataagcgttggcaatttaac
cgccagtcaggctttctttcacagatgtggattggcgataaaaaacaactgctgacgccg
ctgcgcgatcagttcacccgcgcaccgctggataacgacattggcgtaagtgaagcgacc
cgcattgaccctaacgcctgggtcgaacgctggaaggctgcgggccattaccaggcagaa
gcggcgttgttgcagtgcacggcagatacacttgccgacgcggtgctgattaccactgtc
cacgcatggcagcatcagggaaaaaccttatttattagccggaaaacctaccggattgat
ggtagtggtcaaatggcgattaccgttgatgttgaagtagcgagcgatacaccgcatccg
gcacggattggcctgacctgccagctggcgcaggtagcagagcgggtaaactggctcgga
ttagggccgcaagaaaactatcccgaccgccttactgccgcctgttttgaccgctgggat
ctgccattgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgcgctgc
gggacgcgcgaattgaattatggcccacaccagtggcgcggcgacttccagttcaacatc
agccgctacagccaacaacaactgatggaaaccagccatcgccatctgctgcacgcggaa
gaaggaacatggctgaatatcgacggtttccatatggggattggtggcgacgactcctgg
agcccgtcagtatcggcggaattccagctgagcgccggtcgctaccattaccagttggtc
tggtgtcaaaaataa

DBGET integrated database retrieval system