KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0426Help
Entry
ECH74115_0426     CDS       T00778                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ecf00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ecf00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ecf00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:ecf00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:ecf00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
435120..436070
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEEN
VDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacgatcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgcggctttgcgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggagaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggtgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcgcga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattatcgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggatat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggttaatttgccg
ggcgtagggcagttctccgggctgaaaacggcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcagaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system