KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0598Help
Entry
ECH74115_0598     CDS       T00778                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5 3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ECH74115_0598 (tesA)
Enzymes [BR:ecf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECH74115_0598 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ECH74115_0598 (tesA)
Lipid biosynthesis proteins [BR:ecf01004]
 Fatty acid synthase
  Component type
   ECH74115_0598 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(616203..616826)
Genome map
AA seq 207 aa AA seqDB search
MNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKT
SVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDV
KAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFLMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacaatgttttccgctggcatttgcccttcctgtttctggtcctgttaacc
ttccgtgctgccgcagcggacacgttattgattctgggtgatagcctgagcgccgggtat
cgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaaacg
tcggtagtcaatgccagcatcagcggcgacacctcgcaacaagggctggcgcgccttccg
gctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgacggt
ttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggatgtc
aaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggtcgc
cgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgttccg
ctgctgccctttttaatggaagaggtctacctcaagccacaatggatgcaggatgacggt
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgcag
cctttagtaaatcatgactcataa

DBGET integrated database retrieval system