KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0598Help
Entry
ECH74115_0598     CDS       T00778                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5 3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ecf01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(616203..616826)
Genome map
AA seq 207 aa AA seqDB search
MNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKT
SVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDV
KAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFLMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacaatgttttccgctggcatttgcccttcctgtttctggtcctgttaacc
ttccgtgctgccgcagcggacacgttattgattctgggtgatagcctgagcgccgggtat
cgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaaacg
tcggtagtcaatgccagcatcagcggcgacacctcgcaacaagggctggcgcgccttccg
gctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgacggt
ttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggatgtc
aaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggtcgc
cgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgttccg
ctgctgccctttttaatggaagaggtctacctcaagccacaatggatgcaggatgacggt
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgcag
cctttagtaaatcatgactcataa

DBGET integrated database retrieval system