KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0892Help
Entry
ECH74115_0892     CDS       T00778                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
905386..905883
Genome map
AA seq 165 aa AA seqDB search
MSPSLRKAVAAAIGGGAAAIASVLITGPSGDDGLEGVSYIPYEDIVGVWTVCHGHTGKDI
IPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcattacgcaaggctgttgctgctgctattggtggtggggctgctgccata
gcgtctgtgctcatcactggtccgagtggtgacgatggcctggaaggtgtcagctacata
ccatacgaagatatcgttggcgtatggactgtatgtcacggacacaccggaaaagacatc
attcccggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtttacaacgtgggcgctggtaatttcagaacatcgacgcttctt
cgcaaaataaaccagggtgatatcaaaggcgcatgtgatcagctacggcgctggacatac
gctggcggtaagcaatggaaagggctgatgactcgccgcgagattgagcgtgaagtctgt
ttgtgggggcaacaatga

DBGET integrated database retrieval system