KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_2254Help
Entry
ECH74115_2254     CDS       T00778                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
Enzymes [BR:ecf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECH74115_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2140944..2141477)
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGATRGDG
KPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgcaggg
gcgtctgcgcctgaaatcctcgaccagtttctggatgaaaaggaaggtaaccacaccaca
gcataccgtgatggtgcgggtatctggaccatctgccgtggagccacccggggggatggt
aagcctgttattcctggcatgaagctgtcgaaggaaaaatgcgaccgggttaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcagagtgccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggccccggtaagtgtttcccg
tcgacgttttacagacggattaatgcaggagatcgaaaaggtgcctgcgaagcgattcgc
tggtggattaaggacggtggcagggactgccgtattcgctcaaataactgttacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggaatcgacagataa

DBGET integrated database retrieval system