KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_2975Help
Entry
ECH74115_2975     CDS       T00778                                 

Gene name
galF
Definition
(GenBank) regulatory protein GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00040  Pentose and glucuronate interconversions
ecf00052  Galactose metabolism
ecf00500  Starch and sucrose metabolism
ecf00520  Amino sugar and nucleotide sugar metabolism
ecf01100  Metabolic pathways
ecf01130  Biosynthesis of antibiotics
Module
ecf_M00362  Nucleotide sugar biosynthesis, prokaryotes
ecf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECH74115_2975 (galF)
   00052 Galactose metabolism
    ECH74115_2975 (galF)
   00500 Starch and sucrose metabolism
    ECH74115_2975 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ECH74115_2975 (galF)
Enzymes [BR:ecf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECH74115_2975 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ACI38841
Position
complement(2752428..2753321)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcagtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctacgctacaaccttgctgccatgattgcgcgcttcaatgaaacgggacgcagc
caggtgctggcaaaacgtatgccgggcgacctctctgaatactccgtcatccagaccaaa
gaaccgctggatcgtgaaggcaaagtcagccgcattgttgaatttatcgaaaagccggat
cagccgcagacgctggactcagacatcatggccgttggtcgatatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gccattgctgagctggcaaaaaaacaatccgttgatgcaatgctgatgactggcgacagt
tacgactgcggtaaaaaaatgggctatatgcaggcgtttgtgaagtatggactacgcaac
ttgaaagaaggggcgaagttccgcaaaggtatcgagaagctgttaagcgaataa

DBGET integrated database retrieval system