KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_2995Help
Entry
ECH74115_2995     CDS       T00778                                 

Gene name
wzc
Definition
tyrosine kinase (EC:2.7.10.1)
Orthology
K16692  
tyrosine-protein kinase Etk/Wzc [EC:2.7.10.-]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2773700..2775862)
Genome map
AA seq 720 aa AA seqDB search
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADA
LVQIEQSSGNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPI
FGAGWDRLMGRQNETVKVTTFNRPKEMEDQVFTLNVLDNKNYTLSSDGGFSARGQAGQIL
KKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSV
DLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNG
RVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAITQPGVL
KPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGK
TFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTS
IAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVG
TTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaagtaaaacaacatgccgctccggtaacgggcagtgatgaaatcgatatt
ggtcgcctggtcggcaccgtcattgaagcgcgctggtgggtgattggcatcaccgctgta
ttcgccctttgtgccgtggtttacaccttcttcgccacgccgatttatagtgccgacgca
ctggtacaaatcgagcaaagcagcggcaattcgttagtgcaggatatcggatcggcgtta
gccaacaaaccgcctgcatcggacgccgagatccagttgattcgttcgcgcctggtgctt
ggtaaaacggtggatgatctcgacctcgatattgcggtgagcaaaaacacgttcccgatt
ttcggtgcgggctgggatcgcctgatgggacgccagaacgagacggtgaaagtgactacc
tttaaccgtccgaaagagatggaggatcaggtgtttacgcttaatgtgctggacaacaaa
aactacaccctgagcagcgatggcggctttagcgcccgtgggcaagcgggccagatactg
aaaaaagaaggcgtcacgctgatggttgaagccattcacgcccgcccgggcagtgagttt
accgtcaccaaatactccacgctggggatgatcaatcaactgcaaaacagcctgacggta
acggagaacggcaaagacgcaggcgtactgagcctgacttataccggtgaagatcgcgaa
cagatccgcgacattcttaacagcatcgcccgtaactatcaggaacaaaatattgagcgc
aaatcggcggaagcgtcgaaaagcctcgctttcctcgcgcaacagttaccggaagtacgt
agccgccttgatgttgccgaaaacaaactgaatgccttccgtcaggataaagattctgtt
gatctgccgctggaagcgaaagcggtgctcgattcgatggtgaacatcgacgcccagttg
aacgaactgacctttaaagaggcggaaatctccaagctgtacaccaaagttcaccccgcg
taccgcacgctgctggagaaacgtcaggcgctggaagacgaaaaagccaaacttaatggt
cgcgtaacggcgatgccgaaaacccagcaggaaattgtccgtctgacccgcgatgtcgag
tctggtcagcaggtctatatgcaactgctgaataaagagcaggagctgaaaatcaccgag
gccagcaccgtcggcgatgtgcgcattgttgacccggcaatcactcagcctggtgtgcta
aaaccgaagaaagggctgattatccttggggcgattatccttggcctgatgctctctatc
gtgggggtgctgctgcgctcgttgtttaatcgcggcatcgaaagcccgcaggtgctggaa
gaacacggtatcagcgtctatgccagcatcccgctgtcggagtggcagaaagcgcgcgat
agcgtcaaaaccatcaaagggattaaacgctataaacagagccagctactggcggtgggg
aatccaaccgatctggcgattgaagccatccgcagccttcgtaccagtttgcacttcgcg
atgatgcaggcgcagaacaatgtgttgatgatgaccggggttagcccgtcaatcggtaaa
acctttgtctgcgccaacctggcggcggtgatcagccagaccaataaacgcgtgttgttg
atcgactgcgatatgcgcaaaggctacacccatgagctgttgggcactaataacgttaat
ggcctgtcggaaattctgattggtcagggcgatattactacagctgctaaaccgacctct
attgccaaatttgacctgatcccgcgcggtcaggtaccgccaaatccttctgaactgttg
atgagcgaacgctttgccgaactggtgaactgggcgagtaaaaactacgacctggtgttg
attgatacgccgccgattctggcagtgaccgatgcggcaattgttggtcgtcatgtcgga
accacgttaatggtggcgcgttatgcggtcaacacattgaaagaagtggaaaccagtctg
agccgctttgagcaaaacggtattccggtgaaaggggtgattctgaactccatcttccgc
cgcgccagcgcgtatcaggattatggctattacgaatacgaatataagtcggatgcgaaa
taa

DBGET integrated database retrieval system