KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3429Help
Entry
ECH74115_3429     CDS       T00778                                 

Definition
(GenBank) aminotransferase, classes I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00220  Arginine biosynthesis
ecf00250  Alanine, aspartate and glutamate metabolism
ecf00290  Valine, leucine and isoleucine biosynthesis
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01130  Biosynthesis of antibiotics
ecf01210  2-Oxocarboxylic acid metabolism
ecf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECH74115_3429
   00290 Valine, leucine and isoleucine biosynthesis
    ECH74115_3429
   00220 Arginine biosynthesis
    ECH74115_3429
Enzymes [BR:ecf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ECH74115_3429
    2.6.1.66  valine---pyruvate transaminase
     ECH74115_3429
Amino acid related enzymes [BR:ecf01007]
 Aminotransferase (transaminase)
  Class I
   ECH74115_3429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACI34591
Structure
PDB: 

Jmol
Position
3175093..3176310
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPCGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttatgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaacccagccccgttcggttttgacgcgccagatgaaatcctcgttgacgtgatacgc
aacctgcctaccgctcaagggtattgcgattccaaaggtctttactccgcgcgtaaagcc
atcatgcagcactatcaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggggac
gaaatgttggttcctgcaccagattacccactatggaccgcggcggtttcgctttccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggacctcgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
accggcgcggtatattccaaagagcttttaatggagattgtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactcaattgcgccgctggcacctgacctgctgaccattacctttaatggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggctacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcgctgggtggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcgtgggaattgatcaacgatatt
ccgggcgtttcctgcgtgaaaccttgtggtgcgctgtacatgttcccgaaaatcgacgcc
aaacgctttaacattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtcgttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system