KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3442Help
Entry
ECH74115_3442     CDS       T00778                                 

Definition
glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ecf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3188153..3188800
Genome map
AA seq 215 aa AA seqDB search
MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLLISPNNKIPAIVDHSP
ADGGEPLSLFESGAILLYLAEKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNH
AAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYSIADIACWPWVNAWTRQRIDL
AMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctatttcgccccgacacccaatggccacaaaattacgctgtttctcgaa
gaagcagggctggattatcgcttgataaaggtagacctggggaaaggcggtcagtttcgc
ccggaatttttgctcatttcgcctaacaacaaaattccggcaattgttgatcattctcca
gccgatggcggcgaaccgctaagcctctttgaatctggtgccattttgttgtatctggct
gagaaaacggggctctttttgagtcatgaaacgcgtgaacgcgccgccacattacagtgg
ttattctggcaggtaggcggactggggccgatgcttgggcaaaatcatcattttaatcac
gcagccccccaaaccattccttacgctattgaacgttatcaggttgaaactcagcgtctg
taccatgtactgaacaagcggctggaaaactcgccctggctgggaggcgagaactacagc
attgcggatattgcctgctggccgtgggttaatgcctggactcgccagcgaatagacctc
gctatgtatccggcagtcaagaactggcatgagcggatccgttcgcgccctgccaccggg
caggcactgctaaaagcacaactcggtgatgagcgttcggatagttaa

DBGET integrated database retrieval system