KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3442Help
Entry
ECH74115_3442     CDS       T00778                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
Enzymes [BR:ecf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     ECH74115_3442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
3188153..3188800
Genome map
AA seq 215 aa AA seqDB search
MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLLISPNNKIPAIVDHSP
ADGGEPLSLFESGAILLYLAEKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNH
AAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYSIADIACWPWVNAWTRQRIDL
AMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctatttcgccccgacacccaatggccacaaaattacgctgtttctcgaa
gaagcagggctggattatcgcttgataaaggtagacctggggaaaggcggtcagtttcgc
ccggaatttttgctcatttcgcctaacaacaaaattccggcaattgttgatcattctcca
gccgatggcggcgaaccgctaagcctctttgaatctggtgccattttgttgtatctggct
gagaaaacggggctctttttgagtcatgaaacgcgtgaacgcgccgccacattacagtgg
ttattctggcaggtaggcggactggggccgatgcttgggcaaaatcatcattttaatcac
gcagccccccaaaccattccttacgctattgaacgttatcaggttgaaactcagcgtctg
taccatgtactgaacaagcggctggaaaactcgccctggctgggaggcgagaactacagc
attgcggatattgcctgctggccgtgggttaatgcctggactcgccagcgaatagacctc
gctatgtatccggcagtcaagaactggcatgagcggatccgttcgcgccctgccaccggg
caggcactgctaaaagcacaactcggtgatgagcgttcggatagttaa

DBGET integrated database retrieval system