KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3961Help
Entry
ECH74115_3961     CDS       T00778                                 

Gene name
norW
Definition
nitric oxide reductase (EC:1.18.1.-)
Orthology
K12265  
nitric oxide reductase FlRd-NAD(+) reductase [EC:1.18.1.-]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3662076..3663209
Genome map
AA seq 377 aa AA seqDB search
MSNGIVIIGSGFAARQLVKNIRKQDASIPLTLIAADSMDEYNKPDLSHVISQGQRADDLT
RQTAGEFAEQFNLLLFPQTWVTDIDAEARVVKSQNNQWQYDKLVLATGASAFVPPVPGRE
LMLTLNSQQEYRACETQLRDARRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILASL
MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPE
TALARRAGLTINRGVCVDSYLQTSNADIYALGDCAEINGQVLPFLQPIQLSAMVLAKNLL
GNNTPLKLPAMLVKIKTPELPLHLAGETQRQDLRWQINTERQGMVARGVDDADQLRAFVV
SEDRMKEAFGLLKTLPV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggcattgtgatcattggttcgggcttcgccgcccgccaactggtgaaaaat
attcgcaaacaggacgccagtattccattaaccctgattgccgccgacagtatggatgag
tacaacaaacctgacctcagccatgttatcagtcaggggcaacgtgccgacgaccttacc
cgccagacggcgggtgaatttgccgagcagtttaatctgctcctgtttccgcaaacctgg
gtgacggatatcgatgccgaagcccgtgtggtgaaaagccagaataatcagtggcaatac
gacaagctggtgctggcaaccggtgccagcgcctttgtcccgccagtgcctgggcgtgag
ttaatgctgacgttaaatagtcagcaagagtatcgcgcctgtgaaacgcaactgcgggat
gcccgacgcgtgttgattgttggcggtggtttgattggtagcgaactggcgatggatttt
tgtcgtgcaggcaaaatggttacgctaatcgacaacgctgccagtattctggcgtcgtta
atgccaccggaagtaagcagtcgcttgcagcatcggttgacggagatgggcgttcatctg
ctgttgaaatctcagttgcaggggctggaaaaaacggattctggcattctggcaacgctg
gaccaccagcgcagcatcgaagtggatgcggtaattgccgccaccggactgcgcccggaa
accgccctggcacgacgcgccgggctgacgattaatcgcggcgtttgcgtcgatagttat
ctgcaaaccagtaatgccgatatttacgcgctgggcgattgcgcggaaattaacggtcag
gtattgccgttcctgcagccgattcaacttagcgcgatggtgctggcaaaaaatcttctc
ggcaataacacgccgctgaaactaccggcgatgctggtgaaaatcaaaacgccggaatta
ccgctgcatctggcaggcgaaacccagcgtcaggatttacgctggcagattaataccgaa
cgccagggaatggtggcgcgcggtgttgacgatgcagaccaacttcgcgcctttgtggtc
agtgaggatcggatgaaagaggcatttggattgttgaaaacgttgccggtgtag

DBGET integrated database retrieval system