KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3967Help
Entry
ECH74115_3967     CDS       T00778                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECH74115_3967 (ascB)
Enzymes [BR:ecf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECH74115_3967 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3669154..3670578
Genome map
AA seq 474 aa AA seqDB search
MSVFPEGFLWGGALAANQSEGAFREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATGFYHRYKEDIALMAEMGFKVFRTSIAWSRPFPQGDELTPNQQGIAFYRSVFEE
CKKYGIEPLVTLCHFDVPMQLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARVFREKGVTIDKAPGDDEILK
NTVDFVSFSYYASRCASAEMNTNNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDELAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVFVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccagaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggtggcaaaggactgacaacggtcgatatgatcccacacggcgag
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagccatgaggcgacgggtttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaagtgttccgtacctcaattgcctggagccgccccttcccgcag
ggtgatgaactgacgcccaaccagcagggcattgctttttaccgttctgtctttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacattgtgccacttcgatgtgccgatgcag
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gccaggacctgctttgaagcatttgatggtctggtgaaatactggctaaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcggggctggtgtttgaagaaggtgaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagttgcaagccggaagatgtctgggcggcgctggagaaagatcgg
gaaaacctgttttttatcgatgtgcaggcgcggggcgcgtatccggcttactctgctcgc
gtattccgcgaaaaaggggtaaccatcgacaaagcaccgggcgatgatgagatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacaccaacaatagcagtgcggcgaacgtagtgaaatcgctgcgtaacccgtatctacag
gtgagcgactggggctggggaattgatccactcggtctgcgtatcaccatgaacatgatg
tacgaccgctatcagaagccgctgtttctggtggaaaacggcctcggcgcaaaagatgaa
cttgctgccaatggcgagattaacgatgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagatggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctctacgggtgaaatgagcaaacgctacggttttgtcttt
gttgaccgtgacgacgcaggcaacggcacgctgacgcgcacacgtaagaaatcgttctgg
tggtataaaaaagtgattgccagtaatggggaagatttagagtag

DBGET integrated database retrieval system