KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4896Help
Entry
ECH74115_4896     CDS       T00778                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4534370..4535482)
Genome map
AA seq 370 aa AA seqDB search
MKMNVLRSGLVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQS
YGMFFALAANDRAAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGD
VWMAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRF
NPSYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTL
ISSYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPV
GFSAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLP
DWGQECANSH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatgaatgtgttgcgtagtggactcgtgacgatgctgctgttggctgcctttagt
gttcaggcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcag
gaagggcgcgtcatcgaccccagcgacgcgcgcaaaatcaccacctctgaagggcaaagt
tacggcatgttctttgccctggcggctaacgaccgtgcagctttcgataatattctcgac
tggacgcagaacaatctcgctcagggttctttaaaagaacgtttgcccgcctggctgtgg
ggcaagaaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgat
gtctggatggcttggtcgttgctggaggcggggcgtttgtggaaagagcagcgttatacc
gacatcggcagcgcgttgctaaaacgtattgcgcgggaggaagtggtgacggtgcctggg
ctgggttccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgtttt
aaccccagctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtgg
actacgctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcg
ccagactgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattg
atcagcagctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgat
ccgcagaaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaac
ggttatccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccggtc
ggtttttctgccgccatgctgccctttttacaaaaccgtgatgcgcaggccgttcagcgc
cagcgcgtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctg
tttggacaaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacct
gactggggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system