KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5242Help
Entry
ECH74115_5242     CDS       T00778                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00860  Porphyrin and chlorophyll metabolism
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01120  Microbial metabolism in diverse environments
Module
ecf_M00121  Heme biosynthesis, glutamate => heme
ecf_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECH74115_5242 (hemD)
Enzymes [BR:ecf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ECH74115_5242 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 GATase_4
Motif
Other DBs
NCBI-ProteinID: ACI38953
Position
complement(4885861..4886601)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPNYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELIGDTLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
TVVVTSGEMLQQLWSLIPQWYREHWLLHCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatccttgtcacccgcccgtctcccgctggagaagagttagtgagccgtctgcgc
acactggggcaggtggcctggcattttccgctgattgagttttctccgggtcgacaatta
ccgcaacttgctgatcaactggcagcgctgggggagagcgatctgttgtttgccctctcg
caacacgcggttgcttttgcccaatcacagctacatcagcaagatcgtaaatggccccga
ctacctaattatttcgccattggacgcaccaccgcactggcactacataccgtaagcgga
cagaagattctctacccgcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggcaaacgtgcgctgatattacgtggcaatggcggtcgtgagcta
attggggataccctgacggcgcgcggtgctgaggtcactttttgtgaatgttatcaacga
tgcgcaatccattacgatggtgcagaagaagcgatgcgctggcaatcccgcgaggtgacg
acggtcgttgttaccagcggtgaaatgttgcagcaactctggtcgctgatcccacaatgg
tatcgtgagcactggttactacactgtcgactattggtcgtcagtgagcgtttggcgaaa
ctcgcccgggaactgggctggcaagacattaaggtcgccgataacgctgacaacgatgcg
cttttacgggcattacaataa

DBGET integrated database retrieval system