KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5370Help
Entry
ECH74115_5370     CDS       T00778                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00010  Glycolysis / Gluconeogenesis
ecf00030  Pentose phosphate pathway
ecf00051  Fructose and mannose metabolism
ecf00052  Galactose metabolism
ecf00680  Methane metabolism
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01120  Microbial metabolism in diverse environments
ecf01130  Biosynthesis of antibiotics
ecf01200  Carbon metabolism
ecf01230  Biosynthesis of amino acids
ecf03018  RNA degradation
Module
ecf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECH74115_5370 (pfkA)
   00030 Pentose phosphate pathway
    ECH74115_5370 (pfkA)
   00051 Fructose and mannose metabolism
    ECH74115_5370 (pfkA)
   00052 Galactose metabolism
    ECH74115_5370 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ECH74115_5370 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECH74115_5370 (pfkA)
Enzymes [BR:ecf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECH74115_5370 (pfkA)
Protein phosphatases and associated proteins [BR:ecf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECH74115_5370 (pfkA)
Messenger RNA biogenesis [BR:ecf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECH74115_5370 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACI35459
UniProt: B5YZ53
Structure
PDB: 

Jmol
Position
5010625..5011587
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggcatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtttctgac
atgatcaaccgtggcggtacgttcctcggttctgcgcgtttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtgggatcgatgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggcctgccgggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgacgctggct
gcggccattgccggtggctgtgaattcgttgtggttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggttac
ggcggtcgttgcgtaggtatacagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggcgactggctggactgcgcgaaaaaactgtac
taa

DBGET integrated database retrieval system