KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0178Help
Entry
E2348C_0178       CDS       T00796                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ecg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203527..204723
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKTILQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVS
ILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ACASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFC
KLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALN
LSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcaccattctgggctcgaccggctcgattggttgcagcacgctggacgtg
gtgcgccataatcccgaacacttccgcgtagttgcgctggtggcaggcaaaaatgtcact
cgcatggtagaacagtgcctggaattctctccccgctatgccgtaatggacgatgaagcg
agtgcgaaacttcttaaaacgatactacagcaacaggggagtcgcaccgaagtcttaagt
gggcaacaagccgcttgcgatatggctgcgcttgaggatgttgatcaggtgatggcagcc
attgttggcgctgctgggctgttacctacgcttgctgcgatccgcgcgggtaaaaccatt
ttgctggccaataaagaatcactggttacctgcggacgtctgtttatggacgccgtaaag
cagagcaaagcgcaattgttaccggtcgatagcgaacataacgccatttttcagagttta
ccgcaacctatccagcataatctgggatacgctgaccttgagcaaaatggtgtggtgtcc
attttacttaccgggtctggtggccctttccgtgagacgccattgcgcgatttggcaaca
atgacgcccgatcaagcctgccgtcatccgaactggtcgatgggacgtaaaatttccgtc
gattcggctaccatgatgaacaaaggtctggaatacattgaagcgcgttggctgtttaac
gcctgcgccagccagatggaagtgctgattcacccgcagtcagtgattcactcaatggtg
cgctaccaggacggcagtgttctggcgcagctgggtgaaccggatatgcgtacgccaatt
gctcacaccatggcatggccgaatcgcgtgaactctggcgtgaagccgctcgatttttgc
aaactaagtgcgttgacatttgccgcaccggattatgatcgttatccatgcctgaaactg
gcgatggaggcgttcgaacaaggccaggcagcgacgacagcattgaatgccgcaaacgaa
atcaccgtggctgcttttcttgcgcaacaaatccgctttacggatatcgctgcgttgaat
ttatccgtactggaaaaaatggatatgcgcgaaccacaatgtgtggatgatgtgttatct
gttgatgcgaacgcgcgtgaagtcgccagaaaagaggtgatgcgtctcgcaagctga

DBGET integrated database retrieval system