KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0407Help
Entry
E2348C_0407       CDS       T00796                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ecg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454882..455487
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaacacagcttatggaagcactgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgttcacgctgcttcagcgcgatcgtagcggcggg
atgcgtctggcgcaggcgctcacccgggcgatgtcggaaatcggccactgcgccgattgc
cgcaccttcaccgaacaggaagtctgtaacatctgttcgaatccacgtcgtcaggaaaac
ggtcaaatctgcgtggtggagagtccggcggacatttacgccattgagcagacggggcag
ttttcaggtcgttattttgtgttgatggggcatctgtcaccgctggacggcatcggtcct
gatgatatcgggcttgatcgtctggaacagcgtctggcagaggaaaaaatcactgaagtg
atcctcgccaccaaccccacggttgaaggtgaagctaccgctaactacattgccgagctt
tgtgcgcaatatgacgtggaagccagccgaatcgctcatggcgtaccggttggcggcgaa
ctggaaatggtcgatggcaccacgctgtcacactcccttgccgggcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system