KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0690Help
Entry
E2348C_0690       CDS       T00796                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Brite
Enzymes [BR:ecg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     E2348C_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743919..744416
Genome map
AA seq 165 aa AA seqDB search
MSPSLRKAVAAAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MPGKTYTEAECKALLNKDLATVARQINPYINVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcattacgcaaggctgttgcagctgctattggtggtggggctgttgccata
gcgtctgtgctcatcactggtccaggtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatatcgttggcgtatggactgtatgtcacggacacaccggaaaagacatc
atgcccggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacatcaacgtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacggcgctggacatac
gctggcggtaagcaatggaaagggctgatgactcgccgcgagattgagcgtgaagtctgt
ttgtgggggcaacaatga

DBGET integrated database retrieval system