KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0824Help
Entry
E2348C_0824       CDS       T00796                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871533..872045
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDATVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccgggttttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggctgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattggt
aatacgtcgggcgtcattccgggcaaaaccattacggaacgacaggcagcggaagggctg
atctctaacgtgctgcgtgtggagcgggcactggaaaggtgtgtgaagcaacagccgccg
cagaaggtgtatgacgctacggtgtcgtttgccttcaacgtggggacgggcaatgcctgc
agttccacgctggtgaaattgctcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtaaaaggtgtttttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgcttacagggagcaaactga

DBGET integrated database retrieval system