KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1272Help
Entry
E2348C_1272       CDS       T00796                                 

Gene name
purB
Definition
adenylosuccinate lyase
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    E2348C_1272 (purB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E2348C_1272 (purB)
Enzymes [BR:ecg01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     E2348C_1272 (purB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1315746..1317116)
Genome map
AA seq 456 aa AA seqDB search
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFA
ADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFA
CTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTI
GKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQ
WNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPH
KVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQST
LKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMK
QFIDGLALPEEEKARLKAMTPANYIGRAITMVDELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggaattatcctcactgaccgccgtttcccctgtcgatggacgctacggcgataaagtc
agcgcgctgcgcgggattttcagcgaatacggtttgctgaaattccgtgtacaagttgaa
gtacgttggctgcaaaaactggccgcgcacgcagcgatcaaggaagttcctgcttttgct
gccgacgcaatcggttaccttgatgcaattgtcgccagtttcagcgaagaagatgccgca
cgcatcaaaaccatcgagcgtaccactaaccacgacgttaaagcggttgagtatttcctg
aaagaaaaagtggcggagatcccggaactgcacgcggtttctgaattcatccactttgcc
tgtacttcggaagatatcaataacctctcccacgcattaatgctgaaaaccgcgcgtgat
gaagtgatcctgccgtactggcgtcaactgattgatggcattaaagatctcgccgttcag
tatcgcgatatcccgctgctgtcccgtacccacggtcagccagccactccgtcaaccatc
ggtaaagagatggcaaacgtcgcctaccgtatggagcgccagtaccgccagcttaatcag
gtggagatcctcggcaaaatcaatggtgcggtcggtaactacaacgcccacatcgccgct
tacccggaagttgactggcatcagttcagcgaagagttcgtcacctcgctgggtattcag
tggaacccgtacaccacccagatcgaaccgcacgactacattgccgaactgtttgattgc
gttgcgcgcttcaacaccattctgatcgactttgaccgtgacgtctggggttatatcgcc
cttaaccacttcaaacagaaaaccattgctggtgagattggttcttccaccatgccgcat
aaagttaacccgatcgacttcgaaaactccgaaggaaacctggggctttccaacgcggta
ttgcagcacctggcaagcaaactgccagtttcccgctggcagcgtgacctgaccgactcc
accgtgctgcgtaacctcggcgtgggtatcggttatgcgctgattgcgtatcaatccacc
ctgaaaggcgtgagtaaactggaagtgaaccgtgaccatctactggatgaactggatcac
aactgggaagtgctggctgaaccaatccagacagttatgcgtcgctatggcatcgaaaaa
ccgtacgagaagctgaaagagctgactcgcggtaagcgtgttgacgccgaaggcatgaag
cagtttatcgatggtctggcgttgccagaagaagagaaagcccgcctgaaagcgatgacg
ccggctaactacattggtcgcgccatcaccatggttgatgagctgaaataa

DBGET integrated database retrieval system