KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1331Help
Entry
E2348C_1331       CDS       T00796                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ecg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1371052..1371903)
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLSTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEIFTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDVVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVARGVNLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcagcattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgaggttgttgatgaaaactgcggcagac
agcgggcgtctttcgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggttctggtggcgttaaatcat
ctctggcaatgcggactaagcatggatgaactggcggaaatggggctgacgctgggcgca
gatgttcctgtctttgtccgtggtcatgccgcctttgccgaaggtgttggcgaaatattc
acgccggtagacccgccagagaaatggtatctggtcgcacaccctggcgtgagtattccg
acgccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgtggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacggagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgagaggcgttaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system