KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1501Help
Entry
E2348C_1501       CDS       T00796                                 

Gene name
ycjM
Definition
glucosyltransferase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    E2348C_1501 (ycjM)
Enzymes [BR:ecg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     E2348C_1501 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1537449..1539128
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITLRHKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYPQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDDVAPGTVIITETNVPHKDNIAYFGEGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILALVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSKEITRELNDEATLRHAVYHELSRLIKIR
RSHNEFHPDNDFTIDTVNSSVMCIQRSNADGNCLTGLFNFSENIQHINITDLHGRDLISE
VDIVGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacactgcgacat
aaaaaacactgggatgaaagtgatgtcgtgttaatcacctatgccgatcaatttcacagt
aatgatttaaaaccactacccacatttaatcagttttaccctcaatggctgcaaagcatt
ttttcacatgttcatttattacctttttatccatggtcatctgatgatggcttttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgccgtcacccgtccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttactggcgatggtggatgtattgctgtgctacctggaa
aagggcgcagaatatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaagctgttacggtcgattattgat
gacgtagcaccaggtacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgaaggcgatgacgaagcacatatggtgtaccagttctcgctgccgccg
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggctgaacccactgcgtggcttgttacccgaaagcgaaatattagcgctggtcgaggca
ttacagcaggaaggtgcattagtaaactggaaaaataatcccgacggtacgcgcagtccc
tatgaaataaatgtcacctatatggatgcgttaagccgccgcgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattctgggctcgcgtaatgattacgcaggtgtcgaaaaactcgga
tataaccgtgcgattaaccgtaaaaaatatcacagtaaagagataacccgagaactgaac
gatgaagctacattaaggcacgcggtatatcatgaattgtcgcgactaattaaaattcgt
cgaagtcataacgagtttcatccagataatgattttaccatcgacacggttaattcatcc
gtaatgtgtattcaaagaagcaacgcggatggtaattgtctgacaggattgtttaatttc
agtgaaaatattcagcatataaatattactgatctgcatggtcgggatctgattagtgaa
gttgatatagtgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system