KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1645Help
Entry
E2348C_1645       CDS       T00796                                 

Gene name
yneH
Definition
(GenBank) predicted glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00220  Arginine biosynthesis
ecg00250  Alanine, aspartate and glutamate metabolism
ecg00471  D-Glutamine and D-glutamate metabolism
ecg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E2348C_1645 (yneH)
   00220 Arginine biosynthesis
    E2348C_1645 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    E2348C_1645 (yneH)
Enzymes [BR:ecg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     E2348C_1645 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: CAS09193
UniProt: B7URQ1
Position
complement(1710044..1710970)
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacggtagacggttcccga
ttggggattgctatctgtaccgttgacggacagctttttcaggctggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcgccgttcaattct
ttagtgcaactggaaatggagcagggtattccgcgtaatccgtttattaatgccggtgcg
ctggtggtctgcgatatgttgcaagggcgattaagcgcacctcggcaacgtatgctggaa
gttgtgcgcggcttaagtggtgtgtctgatatttcctacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattattgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggcgaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agcggtatgtaccagaacgcgggggagtttgcctggcgggtgggactaccggcaaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgcagtctggagt
ccggaactggatgatgccggtaactcgcttgcgggcattgccgtccttgaacaattgacg
aaacaattagggcgttcagtttattaa

DBGET integrated database retrieval system