KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1645Help
Entry
E2348C_1645       CDS       T00796                                 

Gene name
yneH
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ecg00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ecg00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ecg00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1710044..1710970)
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacggtagacggttcccga
ttggggattgctatctgtaccgttgacggacagctttttcaggctggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcgccgttcaattct
ttagtgcaactggaaatggagcagggtattccgcgtaatccgtttattaatgccggtgcg
ctggtggtctgcgatatgttgcaagggcgattaagcgcacctcggcaacgtatgctggaa
gttgtgcgcggcttaagtggtgtgtctgatatttcctacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattattgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggcgaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agcggtatgtaccagaacgcgggggagtttgcctggcgggtgggactaccggcaaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgcagtctggagt
ccggaactggatgatgccggtaactcgcttgcgggcattgccgtccttgaacaattgacg
aaacaattagggcgttcagtttattaa

DBGET integrated database retrieval system