KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1691Help
Entry
E2348C_1691       CDS       T00796                                 

Gene name
folM
Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    E2348C_1691 (folM)
   00670 One carbon pool by folate
    E2348C_1691 (folM)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     E2348C_1691 (folM)
    1.5.1.-  
     E2348C_1691 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1756250..1756972
Genome map
AA seq 240 aa AA seqDB search
MGKVQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGTPLTDVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGAKEVIDLVDYLLTSCFVTGRSLPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtccagcccttgccaatattaattactggcggtggtcgtcgcatcggcctc
gccctcgcctggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacgcac
tatcccgccattgatggactgattaacgcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggcctgcgt
gctattttgcataacgccagcgcgtggatggcagaaaaaccaggtacaccactgaccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctactcaaccatgcactg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcctatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctaatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaacagcgcctggcgcgaaagaagtgatcgacctggtcgattactta
cttaccagctgctttgtcaccggacgcagtctcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system