KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1852Help
Entry
E2348C_1852       CDS       T00796                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ecg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecg00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ecg00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ecg00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecg00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ecg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1913370..1914299
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLISLLADENVPVATVEAKDWTRQNLHVYVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNHKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctcttgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccggtggcggc
ggcatcaatgtcgcccgcgccattgcccatctgggaggcactgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacatctgatttcactgttggcggatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtatatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
ctcgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
atccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccacaaagaactcagtgcgctggtaaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacacttaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaaccagggaacacgcctgtgctcccatgacgatacg
caaaaaatttacgcgtacctttcccgctaa

DBGET integrated database retrieval system