KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1907Help
Entry
E2348C_1907       CDS       T00796                                 

Gene name
yeaD
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1968382..1969266
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPIIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNSVAIRGGIPLCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDADGVALTFE
LTQSEETKKFWPHDFTLLAHFHVGKTCEIDLEAHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccgatcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcgggtgaagaagaagttctgtgg
ttaagtaacaacacaccgttcaaaaatagcgtcgccattcgcggtggcataccgctttgc
tggccgtggtttggtccggctgcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctgatggtgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggccgcacgactttacgctgttagcgcat
ttccacgtgggtaaaacctgtgaaatcgatcttgaagcacacggcgaatttgaaactacc
tctgcgctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtggacta
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtaatt
aatgacgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccaggaccggcgctttcagttagcatgggcgatatgccggatgatggctac
aagacctttgtttgtgtagaaacggcttacgcttcagaaacgcaaaaagtcaccaaagag
aaacctgcacatctggcgcaatccattcgcgttgcgaaacgttaa

DBGET integrated database retrieval system