KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2007Help
Entry
E2348C_2007       CDS       T00796                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ecg02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ecg02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2065554..2066603)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcccctgatccgctggtt
gcgcgtgatttgattaagaaattcaatcccgatgtattgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgttgtg
atggtttcttccctgaccggcaaagggtcagaagtcacgctgcgcgcgctggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacggcagcaaaggcgagccttgcagcacataagcca
ttgtcggctccgacaacgctgaaggcggggccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagtccggcactgttaattacccagcatatgccgcccggtttcacccgctcttttgcc
gacagacttaataagctttgccagatcggggttaaagaagccgaagacggagagcgcgtc
ttgccgggacatgcctatatcgcgccgggcgatcggcatatggagctggcgcgtagtggc
gcaaattatcaaatcaaaattcacgatggcccggcggttaatcgccatcggccatcggta
gatgtgttgttccattctgtggccaaacaggcggggcgtaatgcggttggggtaatccta
accggtatgggcaacgacggcgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagtcagcaaatgctggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system