KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2037Help
Entry
E2348C_2037       CDS       T00796                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    E2348C_2037 (dcyD)
Enzymes [BR:ecg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     E2348C_2037 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2096004..2096990)
Genome map
AA seq 328 aa AA seqDB search
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPNTQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcataatttaacccgttttccacggctggagtttatcggcgcgccaacgccg
ctcgaatatctgccgcgcttttctgattatcttggacgggaaattttcatcaaacgggat
gacgtcactcccatggcaatgggcggcaataaattacgtaagctggaatttctcgcggca
gatgctctgcgtgaaggtgccgatacgctgattactgccggggcgatccagtctaaccat
gtgcgccagactgccgcagtcgctgcgaaactcggtctgcattgcgtggcgctgctggaa
aatcctattggtacaaccgcggaaaactatttaaccaacggcaatcgtttgttgctggat
ctgttcaatacccagattgaaatgtgcgacgcactgaccgatcccaatacccaactggaa
gagctggcgacgcgagtcgaagcacaaggctttcgcccgtatgtcattccggttggcggt
tctaatgctttgggcgcgctgggttatgtggagagtgcgctggaaatcgcgcaacagtgt
gaaggggcggttaatatttcgtcggtggtggtcgcatcgggcagtgccggaactcacgcc
ggactggctgttgggctggaacacctgatgcctgaaagcgaactgattggcgtgactgtg
tcgcgttctgttgccgatcaattgccgaaagtggttaacctccaacaggcgattgcgaaa
gaactggagctgaccgcatcagcggaaattttactctgggatgactattttgcacctggc
tacggcgtgccgaacgacgaaggcatggaagcagtgaaattgctggcgcggctggaaggc
attctgcttgatcctgtgtataccggaaaagcgatggcggggctgattgacggtatcagt
cagaaacgcttcaaagatgaagggccgattttgtttattcataccggcggtgcgcctgcg
ctgttcgcctatcatccccacgtttag

  All links  
No link information was found.   
DBGET integrated database retrieval system