KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2183Help
Entry
E2348C_2183       CDS       T00796                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    E2348C_2183 (galF)
   00052 Galactose metabolism
    E2348C_2183 (galF)
   00500 Starch and sucrose metabolism
    E2348C_2183 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    E2348C_2183 (galF)
Enzymes [BR:ecg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     E2348C_2183 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2232480..2233373)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGELSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgatacccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctacgctacaaccttgctgccatgattgcgcgcttcaatgaaacgggacgcagc
caggtgctggcaaaacgtatgccgggtgagctctctgaatactcagtcattcagacaaaa
gaaccactggatcgtgaaggtaaagtcagccgcattgttgaattcatcgaaaagccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgtactcagcctggtgcatggggacgtattcagctgactgat
gccattgccgagctggcgaaaaaacagtccgttgatgccatgctgatgaccggcgacagc
tacgactgcggtaaaaaaatgggttatatgcaggcgtttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system