KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2480Help
Entry
E2348C_2480       CDS       T00796                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    E2348C_2480 (fadJ)
   01212 Fatty acid metabolism
    E2348C_2480 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    E2348C_2480 (fadJ)
   00650 Butanoate metabolism
    E2348C_2480 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    E2348C_2480 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    E2348C_2480 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    E2348C_2480 (fadJ)
   00310 Lysine degradation
    E2348C_2480 (fadJ)
   00380 Tryptophan metabolism
    E2348C_2480 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E2348C_2480 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    E2348C_2480 (fadJ)
   00281 Geraniol degradation
    E2348C_2480 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    E2348C_2480 (fadJ)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     E2348C_2480 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     E2348C_2480 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     E2348C_2480 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2578647..2580791)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQIRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEVLARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAV
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASSEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPRGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYCGFAHRDLIIEAVFENLELKQQMVAEVEQNCATHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHASTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERIEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIMPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCDRLVEMSERGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctcaaggcggaatttgcctcgcaggtacgc
gccattattaagcaaatccgtgaaaacaaagagttgcgtggcgtggtgtttgtctccgcg
aaaccagacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagtactggcgcggcaggggcaacagttaatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagttggcg
ctggcgtgccacggtcgtgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggtacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcggta
aagttggggttggtggatgacgtcgttccgcactccatattgctggaagccgctgttgag
ctggcaaagcaggatcgcccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggtaagaaaacagaacacaaaacg
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
ggcaccagcagcggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgccg
caatcgcaggcgctgcgcaatatcttttttgccagttcggaagtgaaaaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcggggcataaatcatgcgctgaagtacagttgggatcagcttgagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactattgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgctactcataccatcttt
gcttcgaacacgtcatctttaccgattggcgatattgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgagtacatcggcgcaaaccatcgccaccacggtaaaactggcgaaaaaacag
ggcaaaacgccaattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacatcaatgaagctatccgcatgttgaccgaaggcgagcgtattgagcatatcgat
gccgcgctggtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattatgcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctgattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatattggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgatcgtttagttgagatgagcgag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system