KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3088Help
Entry
E2348C_3088       CDS       T00796                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    E2348C_3088 (recD)
Enzymes [BR:ecg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     E2348C_3088 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3187935..3189761)
Genome map
AA seq 608 aa AA seqDB search
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLEN
NEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVA
RFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHTRVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERAGQLSRLTGSHVPAGTGTEAASLRDSLCLLQKSYR
FGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLD
LLQARAEPNLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaaagcaattactggaagctgtggagcacaaacagctacgcccactggac
gtgcagtttgccctgaccgtggcgggagatgaacatcctgccgtcaccctcgcggcggca
ctattaagtcatgatgccggagagggacacgtttgtttgccgctttcacgactggaaaat
aacgaggcatcgcatccgctgttggcgacctgtgtcagtgaaatcggtgagctacaaaat
tgggaagaatgcttgctggcttcacaagcggtcagccggggagatgaaccaacgccgatg
atcctctgtggcgatcgtctttatttgaatcgcatgtggtgtaacgagcgcacagtggca
cgctttttcaacgaagtgaatcatgccattgaggttgatgaagctctactggcgcaaacc
ctggacaaactttttccagtaagcgatgaaattaactggcaaaaagttgcggcggcagtg
gcgctgacgcggcggatttcggtgatttccggcggtcctggcaccggtaaaacgaccacc
gtagcgaagttgctggcagccttaattcaaatggccgacggcgaacgctgccgtatccgt
ctggctgcaccaacgggtaaagctgccgcgcgcttaaccgaatctctcggcaaggctttg
cgacaattaccgctgaccgatgaacaaaagaaacgcattccggaagatgccagcactttg
caccgattgctgggtgcgcagccgggtagccagcgtttacgtcatcatgccggtaacccg
ctgcatcttgatgtgctggtggtagatgaagcgtcaatgatcgatcttcctatgatgtcg
agactgatcgacgccttgcctgatcatacgcgagtgatctttctcggcgatcgtgatcaa
ctggcctcggttgaggctggggctgtgctgggcgatatctgcgcttatgccaacgcgggc
tttaccgccgagcgtgccgggcagttgagccgcctgacgggaagccacgttccagcagga
actggcacagaagcggcatctttgcgcgacagcctctgcctgctgcaaaaaagctatcgt
ttcggcagcgattctggcattggtcagttagctgcggcgattaaccgtggtgataaaacg
gcagtgaaaaccgtttttcagcaggattttactgatatcgaaaaacgacttttacagagc
ggcgaagattatattgcgatgcttgaggaagctcttgcgggttacggacgttatctggat
ctgctgcaagcgcgtgccgagccgaatttaatcattcaggcgttcaatgagtaccagctt
ttgtgcgccctgcgggaagggccgtttggcgtggctggactgaatgagcgaattgagcag
tttatgcaacagaagcgcaaaattcatcgtcatccgcactctcgttggtacgaaggtcga
ccggtgatgattgcccgtaatgacagcgcgcttgggttgtttaatggcgatatcggtatt
gcgctggatcgcgggcaggggacgcgcgtctggtttgcgatgccggacggcaatattaag
tctgtgcaaccgagtcgcttgccagagcacgaaacgacgtgggcgatgacggtacataaa
tcgcagggatcggagttcgaccatgcggcgttgattttaccgagtcaacgcacgccggta
gtaacgcgagagctggtttacaccgcagtgacccgcgcgcgtcgccgtctgtcgctgtat
gccgatgagcgcatattaagtgcggcaatcgccactcgtactgagcggcgcagtggtctg
gcggcgttgtttagttcacggggataa

DBGET integrated database retrieval system