KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3661Help
Entry
E2348C_3661       CDS       T00796                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3797605..3799689)
Genome map
AA seq 694 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSISAETKRRLLDAMHQRTATKVAVTPVPNVMVY
TSGKKMPMVVEGSGEYSWLLTTEEGTQYKGHVTGGKAFNLPTKLPEGYHTLILTQDDQRA
HCRVIVAPKRCYEPQALLNKQKLWGACVQLYTLRSEKNWGIGDFGDLKAMLVDVAKRGGS
FIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFHLSEEALAWWKLPTTQQT
LQQARDADWVDYSTVTTLKMTALRMAWKGFAQRDDEQMTAFRQFVAEQGDSLFWQAAFDA
LHAQQVKEDEMRWGWPAWPEMYQNVDSPEVRQFCEEHRDDVDFYLWLQWLAYSQFAACWE
ISQGYEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDP
HIITARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLLS
ILALESKRHRCMVIGEDLGTVPVEIVGKLRSSGVYSYKVLYFESDHEKTFRAPKAYPEQS
MAVAATHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKHGCL
PKRAGHKASLMSMTPMLNRGLQRYIADSNSALLGLQPEDWLDMAEPVNIPGTSYQYKNWR
RKLSATLETMFADDGVNKLLKDLDRRRRAAAKKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgtctggataatgccgcgctggcggcggggattagccccaattacatc
aatgcccacggtaaaccgcagtcgattagcgccgaaaccaaacggcgtttgcttgacgcg
atgcatcaacgtaccgccacgaaagtggcggtaacaccagtcccgaatgtcatggtttat
accagcggcaaaaaaatgccgatggtggtggagggcagcggcgaatatagctggctgctg
accaccgaagaaggaacgcagtacaaaggccatgtaacggggggcaaagcgttcaatcta
ccgacgaagctgccggaaggttatcacacgctgatactcacccaggacgaccagcgcgcg
cattgccgggtgattgtcgccccgaaacgctgttacgaaccgcaggcgttgctgaacaaa
caaaagctgtggggtgcctgcgttcagctttatacgctgcgatcggaaaaaaactggggt
attggggattttggcgatctcaaagcgatgctggtggatgtggcaaaacgtggcgggtcg
ttcatcggtctgaacccgattcatgcgctctatccggcaaatccggaaagtgccagcccg
tatagcccgtcttctcgccgttggctgaatgtgatttatatcgacgttaacgccgttgaa
gatttccatcttagcgaagaggctctggcctggtggaagttgccgaccacgcaacagacg
ctgcaacaggcgcgggatgccgactgggttgattactccacggttaccaccctaaaaatg
acagcattacgaatggcgtggaaaggtttcgcgcaacgtgatgatgagcagatgaccgcg
tttcgccagtttgttgcagagcagggcgacagcctgttctggcaggcagcctttgatgcg
ctacatgcccagcaagtgaaagaggacgaaatgcgctggggctggccagcatggccagag
atgtatcagaacgtggattcaccagaagtgcgccagttctgcgaagaacatcgtgatgac
gtcgatttttatctctggttgcagtggctggcttacagccagtttgccgcctgctgggag
ataagccagggctatgaaatgccgattggcttgtatcgtgatctggccgttggtgtagca
gaaggtggggcagaaacctggtgcgaccgtgaactgtattgcctgaaagcgtcggttggc
gcgccgccggatatcctcggcccgttggggcagaactggggattgccgccaatggacccg
catatcatcaccgcgcgtgcctatgaaccgtttatcgagctgttgcgtgccaatatgcaa
aactgcggcgcattacgaattgatcacgtgatgtcgatgctgcgtttgtggtggataccg
tatggcgagacggcagatcagggcgcgtatgttcactatccggtagatgatctgctctcg
attctggcactcgaaagtaagcgccatcgctgcatggtgattggtgaagacctcggcact
gtaccggtagagattgtcggtaaactgcgcagcagcggtgtgtactcctacaaagtgctc
tatttcgaaagcgaccacgagaagacattccgcgcgccgaaagcgtatccggagcagtcg
atggcggttgcggcgacacacgacctgcctacactgcgtggctactgggagagcggggat
ttaacactgggtaaaacgctggggctgtacccggatgaagtggtattgcgcggtctgtat
caggatcgcgaactggcgaagcaagggttgctggatgcactgcataaacatggttgcctg
ccaaaacgtgcggggcataaggcatcgttaatgtcgatgacgccgatgcttaatcgtggt
ttgcaacgttatatcgctgatagtaacagtgctctgttagggcttcagccagaagactgg
ctggatatggccgaaccggtaaatattcctggcaccagctaccagtacaaaaactggcga
cgcaagctttccgcaacgcttgagacgatgtttgccgatgatggcgtgaacaagttgctg
aaggatttggacagacggcgcagagcggcagcgaagaagaagtag

DBGET integrated database retrieval system