KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4121Help
Entry
E2348C_4121       CDS       T00796                                 

Gene name
pldA
Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ecg00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ecg00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ecg00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ecg00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ecg00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4304836..4305705
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYI
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSDESSPFRETNYEPQLFLGFATDYNFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcaccctttatccttatgacaccaactacatc
atctacacccaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aacgcgcgtaaggatgaagtaaagttccagttgagcctggcgtttccgctgtggcgtggg
attttggggccaaactctgtactgggcgcctcctacacacagaaatcctggtggcagctt
tctaatagcgatgagtcatcaccgtttcgtgaaactaactacgaaccgcaattgttcctc
ggttttgccacggattacaactttgctggctggacgctgcgcgatgtggaaatgggctac
aaccacgactcaaacgggcgttcagacccgacttcccgcagctggaaccgcctttatacc
cgcctgatggcagaaaacggtaactggctggtagaggtgaagccgtggtatgtggtgggg
aatacggacgataacccggacatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtactgagcgcgaaagggcagtacaactggaacaccggttac
ggcggcgcggagttaggcttaagctacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggttacggcgaatcgctcatcgactataacttcaaccagacccgcgttggt
gtgggagttatgctaaacgacctgttttga

DBGET integrated database retrieval system