KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4158Help
Entry
E2348C_4158       CDS       T00796                                 

Gene name
fadB
Definition
(GenBank) fused 3-hydroxybutyryl-CoAepimerase/delta(3)-cis-delta(2)-trans-enoyl-CoAisomerase/enoyl-CoA hydratase/3-hydroxyacyl-CoAdehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00071  Fatty acid degradation
ecg00280  Valine, leucine and isoleucine degradation
ecg00281  Geraniol degradation
ecg00310  Lysine degradation
ecg00362  Benzoate degradation
ecg00380  Tryptophan metabolism
ecg00410  beta-Alanine metabolism
ecg00640  Propanoate metabolism
ecg00650  Butanoate metabolism
ecg00903  Limonene and pinene degradation
ecg00930  Caprolactam degradation
ecg01040  Biosynthesis of unsaturated fatty acids
ecg01100  Metabolic pathways
ecg01110  Biosynthesis of secondary metabolites
ecg01120  Microbial metabolism in diverse environments
ecg01130  Biosynthesis of antibiotics
ecg01200  Carbon metabolism
ecg01212  Fatty acid metabolism
Module
ecg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    E2348C_4158 (fadB)
   00650 Butanoate metabolism
    E2348C_4158 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    E2348C_4158 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    E2348C_4158 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    E2348C_4158 (fadB)
   00310 Lysine degradation
    E2348C_4158 (fadB)
   00380 Tryptophan metabolism
    E2348C_4158 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E2348C_4158 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    E2348C_4158 (fadB)
   00281 Geraniol degradation
    E2348C_4158 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    E2348C_4158 (fadB)
   00930 Caprolactam degradation
    E2348C_4158 (fadB)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     E2348C_4158 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     E2348C_4158 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     E2348C_4158 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     E2348C_4158 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAS11706
UniProt: B7UNH4
Position
complement(4345059..4347248)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGTGIMGGGIAYQSAWKDVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFNANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgccaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctcccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctcggtgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggtgtagtcaaagcagaaaaactggttgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaagggatggtc
gcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagcg
gcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtgctgggc
acaggcattatgggcggcggcatcgcctaccagtctgcgtggaaagacgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccaca
attcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgtccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatgccgttg
gtggaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggtcaacgactgccccggcttcttcgtcaac
cgtgtactgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggcatatctg
ctggatgttgtgggcattgacaccgcacatcatgcccaggcagtcatggcagcaggcttc
ccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttaatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgctgttgacgacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtc
cgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggcagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtaccg
gaaggtctgcgtaataaagcacgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system