KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4220Help
Entry
E2348C_4220       CDS       T00796                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00010  Glycolysis / Gluconeogenesis
ecg00030  Pentose phosphate pathway
ecg00051  Fructose and mannose metabolism
ecg00052  Galactose metabolism
ecg00680  Methane metabolism
ecg01100  Metabolic pathways
ecg01110  Biosynthesis of secondary metabolites
ecg01120  Microbial metabolism in diverse environments
ecg01130  Biosynthesis of antibiotics
ecg01200  Carbon metabolism
ecg01230  Biosynthesis of amino acids
ecg03018  RNA degradation
Module
ecg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E2348C_4220 (pfkA)
   00030 Pentose phosphate pathway
    E2348C_4220 (pfkA)
   00051 Fructose and mannose metabolism
    E2348C_4220 (pfkA)
   00052 Galactose metabolism
    E2348C_4220 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    E2348C_4220 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    E2348C_4220 (pfkA)
Enzymes [BR:ecg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     E2348C_4220 (pfkA)
Protein phosphatases and associated proteins [BR:ecg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     E2348C_4220 (pfkA)
Messenger RNA biogenesis [BR:ecg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     E2348C_4220 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAS11768
UniProt: B7UNN6
Structure
PDB: 

Jmol
Position
4422677..4423639
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggcatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtttctgac
atgatcaaccgtggtggtacgttcctcggttctgcgcgtttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtgggatcgacgcgctggtggtt
atcggcggtgacggctcctacatgggggcaatgcgtctgaccgaaatgggcttcccgtgc
atcggcctgccgggcactattgacaacgacatcaaaggcactgactacacgatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgacgttggct
gcggccattgccggtggctgtgaattcgttgtggttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggc
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgagctgctgctggcaggttac
ggtggtcgttgcgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggcgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system