KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4228Help
Entry
E2348C_4228       CDS       T00796                                 

Gene name
fpr
Definition
ferredoxin-NADP reductase
Orthology
K00528  
ferredoxin--NADP+ reductase [EC:1.18.1.2]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Brite
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     E2348C_4228 (fpr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4428851..4429597)
Genome map
AA seq 248 aa AA seqDB search
MADWVTGKVTKVQNWTDALFSLTVHAPVLPFTAGQFTKLGLEIEGERVQRAYSYVNSPDN
PDLEFYLVTVPDGKLSPRLAALKPGDEVQVVSEAAGFFVLDEVPDCETLWMLATGTAIGP
YLSILQLGKDLERFKNMVLVHAARYAADLSYLPLMQELEKRYEGKLRIQTVVSRETAAGS
LTGRLPALIESGELESAVGLPMNKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPG
HMTAEHYW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgattgggtaacaggcaaagtcactaaagtgcagaactggaccgacgccctgttt
agtctcaccgttcacgctcccgtgcttccgtttaccgccgggcaattcaccaaacttggc
cttgaaattgaaggcgaacgcgttcagcgcgcctactcctatgttaactcgcccgataat
ccggatctggagttttacctggtcaccgtccccgatggcaaattaagcccgcgactggcg
gcactgaaaccgggcgatgaagtgcaggtggttagcgaagccgctggcttctttgtgctg
gatgaagtaccagattgcgaaacgctatggatgctggcaaccggtacagcgattggccct
tatttatcgattctgcaattgggcaaagatttagaacgcttcaaaaacatggtgctggtt
cacgccgcacgatatgccgccgacttaagctatctacctctgatgcaggaactggaaaaa
cgctacgaggggaaactgcgcattcagacggtggtcagtcgggaaacggctgcgggttcg
ctcactgggcgattaccggcgttaattgaaagtggtgaactggaaagcgcggttggcctg
ccgatgaataaagaaaccagccatgtgatgctgtgcggcaatccacagatggtgcgcgat
acacaacagttgctgaaggagacccggcagatgacgaaacatttacgtcgccgaccgggc
catatgacagcggagcattactggtaa

DBGET integrated database retrieval system