KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4371Help
Entry
E2348C_4371       CDS       T00796                                 

Definition
dihydrolipoyltranssuccinase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    E2348C_4371
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E2348C_4371
  Amino acid metabolism
   00310 Lysine degradation
    E2348C_4371
Enzymes [BR:ecg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     E2348C_4371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4605476..4606630
Genome map
AA seq 384 aa AA seqDB search
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAVIEETVTPVTETLTMPSARLEAQRSGVELADVAGSGRNGRI
LKEDVQRVTPAPAIQPERVAEIAPAKPLTPGARQERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRARWKDRFAEKHGVKLGFMSFFVKAVTRALERFPVVNASVDGNEI
IWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVEIERQIAEYATQARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVQTLVAIRELLESPEQLLLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattactgtccctgtattaccggaatctgtcacggaaggcacgctgacaacc
tggtgtaaacaagaaggcgagcacgtaaaacgcgatgatgtgattgccgagctggaaacc
gataaagtcattctggaaataccggccccgcacgatggcgtgttaagcaatattatcgtc
agcgaaggtagcacggtcacgtccgcgcaactgttggcgcatcttaagccgcaagctgtc
atagaagaaaccgtcacaccagtcaccgaaaccctgacgatgccttccgcacggctggag
gcacagcgtagtggtgtcgaacttgctgacgttgcggggagcgggagaaatggacgtatc
ctgaaagaggatgtgcagcgcgttactcctgcaccagccattcagcctgaacgggtggcg
gagatcgcgccagctaaacccttgacaccgggtgctcgtcaggaacgtcgtgagccgatg
tcgcgcttacgtcagcgaattgctgagcgtctgctggcttcccaacaaaataacgccatt
cttaccacattcaacgaagtaaacatgcagagcgtgatggatttacgcgcccgctggaaa
gatcgttttgccgagaagcacggcgtgaagctgggctttatgtccttctttgttaaggcc
gttacccgggcgctggagcgcttccctgtagtgaatgccagcgttgatggtaacgagatt
atctggcgtgattattgcgatatcggcattgcagtgagcagcaaccgcggcctggtagtg
cctgtgttacgcaatgcgcaatcactctctttggtggaaattgaacggcaaattgccgaa
tacgccacacaggctcgcaatggcaaattgccgctggaggcgttacagggcggcacgttc
tctatcaccaacggcggtacttttggttcgatgatgtcaacgccaatcattaacccgccg
cagtcggccattcttgggatgcatgccatcacgccgcgcccggtcgcagaaaacggccag
gttgttattcgtcccatgatgtaccttgctctcagctatgaccatcgcattattgatggg
caggaagccgttcagacgctggtggcaatacgcgagctactggagtcaccggaacaactg
ttgctggatctttaa

DBGET integrated database retrieval system