KEGG   Ehrlichia chaffeensis Arkansas: ECH_0082Help
Entry
ECH_0082          CDS       T00328                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECH_0082 (rpe)
   01230 Biosynthesis of amino acids
    ECH_0082 (rpe)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECH_0082 (rpe)
   00040 Pentose and glucuronate interconversions
    ECH_0082 (rpe)
Enzymes [BR:ech01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     ECH_0082 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
74019..74705
Genome map
AA seq 228 aa AA seqDB search
MLTKKNSFNRGKVVEVSSSILSADFANLGKSVEMLTDAGVDYIHVDVMDGNFVPNITIGP
VVVSAIKKYTTIPFDVHLMINSPGNYIEAFVDAGADMITIHAESDIHLDRIIQKIKSYKK
SAGLSLVPTSHYNILEYIIFELDLVLIMTVNPGFGGQQFITSQLDKISCVRNLIEKYSLK
TKIAVDGGVNIKNAKSVIEAGADILVVGSAIFNANNMLDYVQQLKSSF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgttaacgaaaaaaaatagttttaatcgaggaaaagttgtagaagtctctagttctata
ttgtcagcagattttgctaatttaggtaagtcagtggaaatgttgacagatgcgggtgta
gattatatccatgtggatgtgatggatggtaattttgtgcctaatatcactataggacct
gttgttgtttctgcaataaagaaatatacaaccatcccatttgatgtgcacctcatgatt
aattctcctggtaattatatagaggcttttgttgatgcaggagcagatatgattactatt
catgcagaatccgatatacatttagatcgtataatacagaagattaagtcttataagaaa
agtgctggattatctcttgttccaacatctcactataatattttagaatatattattttt
gagcttgatcttgtgttgattatgacagtaaatcctggctttggcggtcaacaatttatc
acatctcagttagataaaatttcatgtgttcgtaatctaatagaaaaatattcattgaaa
actaaaatagctgtggatggtggtgttaatattaagaatgctaaaagtgtaattgaagct
ggtgcagatattttagttgttggatctgcaatttttaatgcaaataacatgttagattat
gtacaacaacttaagtcctctttctag

DBGET integrated database retrieval system