KEGG   Ehrlichia chaffeensis Arkansas: ECH_0082Help
Entry
ECH_0082          CDS       T00328                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00030  Pentose phosphate pathway
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01200  Carbon metabolism
ech01230  Biosynthesis of amino acids
Module
ech_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECH_0082 (rpe)
   00040 Pentose and glucuronate interconversions
    ECH_0082 (rpe)
Enzymes [BR:ech01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     ECH_0082 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim IMPDH His_biosynth PcrB NanE TMP-TENI ComA OMPdecase YmdB QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABD45303
UniProt: Q2GI21
Position
74019..74705
Genome map
AA seq 228 aa AA seqDB search
MLTKKNSFNRGKVVEVSSSILSADFANLGKSVEMLTDAGVDYIHVDVMDGNFVPNITIGP
VVVSAIKKYTTIPFDVHLMINSPGNYIEAFVDAGADMITIHAESDIHLDRIIQKIKSYKK
SAGLSLVPTSHYNILEYIIFELDLVLIMTVNPGFGGQQFITSQLDKISCVRNLIEKYSLK
TKIAVDGGVNIKNAKSVIEAGADILVVGSAIFNANNMLDYVQQLKSSF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgttaacgaaaaaaaatagttttaatcgaggaaaagttgtagaagtctctagttctata
ttgtcagcagattttgctaatttaggtaagtcagtggaaatgttgacagatgcgggtgta
gattatatccatgtggatgtgatggatggtaattttgtgcctaatatcactataggacct
gttgttgtttctgcaataaagaaatatacaaccatcccatttgatgtgcacctcatgatt
aattctcctggtaattatatagaggcttttgttgatgcaggagcagatatgattactatt
catgcagaatccgatatacatttagatcgtataatacagaagattaagtcttataagaaa
agtgctggattatctcttgttccaacatctcactataatattttagaatatattattttt
gagcttgatcttgtgttgattatgacagtaaatcctggctttggcggtcaacaatttatc
acatctcagttagataaaatttcatgtgttcgtaatctaatagaaaaatattcattgaaa
actaaaatagctgtggatggtggtgttaatattaagaatgctaaaagtgtaattgaagct
ggtgcagatattttagttgttggatctgcaatttttaatgcaaataacatgttagattat
gtacaacaacttaagtcctctttctag

DBGET integrated database retrieval system