KEGG   Ehrlichia chaffeensis Arkansas: ECH_0098Help
Entry
ECH_0098          CDS       T00328                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00010  Glycolysis / Gluconeogenesis
ech00020  Citrate cycle (TCA cycle)
ech00620  Pyruvate metabolism
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01200  Carbon metabolism
Module
ech_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECH_0098 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ECH_0098 (pdhC)
   00620 Pyruvate metabolism
    ECH_0098 (pdhC)
Enzymes [BR:ech01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ECH_0098 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 YdjC
Motif
Other DBs
NCBI-ProteinID: ABD44627
UniProt: Q2GI07
Position
87593..88843
Genome map
AA seq 416 aa AA seqDB search
MPIEVLMPALSPTMKSGTIRKWYKAEGDVVKSGDVIADIETDKAVMECEYTDEDGIMGKI
FFAEGSKNIEVNQLIALIAVDEQDLAKVHSYEKGDNVVKNELVALQDSQPAQDESVVLQM
NQQIVNASEVLVNSSNSSERVKVSPLAKKIASNLGVDVNLVKGTGPYGRIIKADILDVIN
QHGHIANSPEDASFTEISSMRRVIAERLVYSKQTIPHFYVSIDCLVDSLLKLRLEINAEN
PDTKVTVNDFIIKAVAMSIKKFPEINVSWSDDKIVVFPSIDISVAVSIDNGLITPIIFGA
DKKSLLEISREVKALASKAKSGKLKPEEFQGGGFTVSNLGMFGIKEFYAIVNPPQSCIMS
VGCSEKRAMVVNEQICISNVVTVTLSVDHRVIDGVLAAKFLNCFKSYLEKPFLMLI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccaatagaagtattgatgcctgctctttctccaactatgaaaagtggcactataaga
aagtggtataaagcagaaggggatgtagtaaaatcaggtgatgtaatagctgatatagaa
actgataaagctgttatggaatgtgagtatacagatgaagatggtatcatgggtaaaatt
ttttttgctgaaggaagcaaaaatatagaggtaaatcaattgatagcattgattgctgta
gatgaacaggatttagctaaagttcattcatatgaaaaaggtgataatgttgtaaaaaat
gagttagttgcgttacaagatagtcaacctgctcaagatgagtcagttgtattgcaaatg
aatcaacaaattgtgaatgctagcgaagtattggttaattcatctaattcttctgaaaga
gttaaggtgagtcctttagcaaaaaaaattgcttcgaaccttggtgttgatgtaaatttg
gtaaaaggaacaggcccgtacggtaggattataaaagctgatatattggatgttataaat
cagcatggtcacattgctaactctcctgaggatgcttcttttactgaaattagtagtatg
cgtagagtaatagcagaacgtttagtgtattcaaaacaaacaattcctcacttttacgtt
tcaatagattgtcttgtggatagtttgttaaaattaaggttagaaataaatgctgaaaat
cctgatactaaggttacagtgaatgatttcatcattaaagctgttgccatgagtattaag
aaatttcctgaaattaatgtatcttggtctgatgataagatagttgtatttcctagtatt
gatatttctgttgctgtatctattgataatggacttatcacaccaattatttttggtgca
gataagaaatctttgttagaaatatcaagagaagtgaaagcattagctagtaaggctaaa
tctggaaaattgaaacctgaagaatttcaaggcggaggttttactgtttctaatcttggt
atgtttggtattaaagaattctacgcaattgttaatcctccacagtcttgtataatgtct
gttggatgctctgaaaaacgagcaatggttgttaatgagcaaatatgtatttcaaatgtt
gtgacagtaacattatctgtagaccatagagttattgatggtgtactagcggcaaaattt
ttaaattgctttaaatcttatctagagaaaccatttttaatgttgatataa

DBGET integrated database retrieval system