KEGG   Ehrlichia chaffeensis Arkansas: ECH_0144Help
Entry
ECH_0144          CDS       T00328                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00300  Lysine biosynthesis
ech01100  Metabolic pathways
ech01120  Microbial metabolism in diverse environments
ech01230  Biosynthesis of amino acids
Module
ech_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ECH_0144 (dapE)
Enzymes [BR:ech01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ECH_0144 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABD45523
UniProt: Q2GHW1
Position
complement(134773..135918)
Genome map
AA seq 381 aa AA seqDB search
MAIDPVILSQELISFPSITPTDNGAIDFLSNTLSQYGFTCNVLTFGNDEVQVCNLYAQLG
NGHPNLCFAGHTDVVPTGDLEKWKFDPFSGHIEDNILYGRGAVDMKSAICAFIAAVSRID
FNQVNGAISLMISGDEEGNHFKYGTPAILKWLTDNNKKIDYCLVGEPTSKSSVGDTIKIG
RRGSINFKIVCNGVQGHVAYPHLAQNPINDMINILHKINNTVLDEGNEYFQPSNCEITSV
DVGNTANNVIPGTVTAHLNIRYNNIHTSESLFNIINNICAETTQKYQIFTSLSGDPFINY
PDKYSDMLSAAIKKTTGETAVISTSGGTSDARFIKDFCPVIELGLKNDTAHKINENTSVD
DINKLANIYEEFIKQFFNISQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggctattgacccagtaatattatcccaagaattaatatccttccctagcattactcca
acagataacggtgccatagactttctatcaaacactctatcacaatatggattcacatgt
aatgttttaacttttggaaatgatgaagtgcaagtatgtaatttatatgcacaattagga
aatggtcatcctaatctatgttttgcaggacatacagatgtagtcccaacaggagactta
gaaaaatggaaatttgaccctttttctgggcacatagaagataacattctatatgggcgt
ggagctgttgatatgaaatctgccatatgcgccttcatagcagcagtatcaagaatagat
ttcaatcaagtaaatggtgctattagtctaatgatttctggagatgaagaaggtaaccat
tttaaatatgggacacctgcaatattgaaatggctaaccgataataataaaaaaattgat
tactgtttagttggagaaccaacaagtaaatcctctgtaggagatactataaaaataggt
cgtagagggtcaatcaatttcaagatagtgtgtaatggtgtacaagggcatgttgcctat
ccacaccttgcacaaaatccaataaatgatatgatcaacattttacataaaataaacaat
acagttctcgatgaagggaatgaatattttcaaccttcaaattgcgaaattacatctgtt
gatgtgggaaatacagcaaataacgttattccaggcacagttaccgctcatcttaacatt
agatataataatatacacacctctgaatcattatttaatataatcaacaatatttgtgct
gaaacaacacaaaaataccaaatatttacatcattatctggagatccattcattaattac
cctgacaaatattctgatatgctatctgcagccataaaaaagacaactggggaaactgca
gtaataagtacatctggtggcacatcagatgcaaggtttataaaagatttttgtcctgtg
attgagctaggattaaaaaatgataccgcacataaaataaacgaaaatacatctgtagat
gacataaacaaactggctaacatatacgaagagttcataaagcagttttttaatatatct
cagtag

DBGET integrated database retrieval system