KEGG   Ehrlichia chaffeensis Arkansas: ECH_0320Help
Entry
ECH_0320          CDS       T00328                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECH_0320 (ruvA)
Enzymes [BR:ech01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ECH_0320 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309386..309958)
Genome map
AA seq 190 aa AA seqDB search
MIGSLTGIIEEIYNNYIILNVGNVGYIIYVSHKVLQSCKTGNNIKLYIETYVNRDNLTQL
YGFLDKQEQDYMRMLVTINGINHKTAISILSKLSPEQIFSAVVSNNKNAFRGNGIGEKLA
GRITTELQYKISKMPIEETLIIKEDDSLAALISLGYDKLKAFNAIQEIKANFPDDSIQEI
IRKALQKLSQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgataggtagtcttacaggtattatagaagaaatatacaataactacatcatattaaac
gtaggaaacgttggatatataatttacgtttcacataaagtattacaaagttgcaaaact
ggaaataacattaaactttacatagaaacctatgtaaacagagataatctaactcagttg
tatggattcttagataaacaagaacaagattacatgagaatgctagttacaataaatggt
attaaccataaaacagctatctcaatattaagtaaactatcaccagaacaaatcttttct
gcagtagtaagtaacaacaaaaacgcatttaggggaaatggtataggagaaaaacttgca
ggacgtattacaactgaacttcaatataagattagtaaaatgccaatagaagaaaccctc
ataataaaagaagatgattcgttagctgctcttataagtttagggtatgacaaactaaaa
gctttcaatgcaatacaagaaataaaagccaattttcctgatgacagcatacaagaaatt
atacgaaaagcattgcaaaaactttctcaatag

DBGET integrated database retrieval system