KEGG   Ehrlichia chaffeensis Arkansas: ECH_0327Help
Entry
ECH_0327          CDS       T00328                                 

Gene name
cycM
Definition
(GenBank) cytochrome C, membrane-bound
  KO
K08738  cytochrome c
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ech00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECH_0327 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABD44791
UniProt: Q2GHD6
Position
complement(314581..315099)
Genome map
AA seq 172 aa AA seqDB search
MDGFHLNKIFTAILFASFIVLFISNVVNLLYDPDPHAEQTKGYKINIEEHIPTEVNNTEE
QIDIESLIAQANIAKGKDLTKKCISCHTFEKGGANRVGPNLWHIVGNKKAHLGDSFNYSK
AMLSKGGTWEYQDLFQFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLKSLE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggacggattccacttaaacaagatatttacagccattttatttgcatcatttatagta
ctgtttattagcaatgtggtaaatttattatacgatcccgatccacatgctgaacagaca
aaaggttataaaataaatatagaagaacatattccaacagaagtcaataatactgaagaa
caaatcgacattgaatctctaatagcacaagctaatattgcaaaaggcaaagatctcaca
aaaaagtgcatatcttgtcatacttttgaaaaaggaggagcaaatagagtaggaccaaat
ttatggcacattgtaggcaacaaaaaagcacatctaggggacagcttcaattactcgaaa
gcaatgctaagcaagggcggcacatgggaatatcaagatctatttcagtttttaacaaaa
cctcaagcttatattaaaggtacacgcatggcatttgctggtatttcaaagccccaagac
gtagcagacttaattgcatacttgaaatctttggaataa

DBGET integrated database retrieval system