KEGG   Ehrlichia chaffeensis: ECH_0327Help
Entry
ECH_0327          CDS       T00328                                 

Gene name
cycM
Definition
cytochrome C, membrane-bound
Orthology
K08738  
cytochrome c
Organism
ech  Ehrlichia chaffeensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ech00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ech02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(314581..315099)
Genome map
AA seq 172 aa AA seqDB search
MDGFHLNKIFTAILFASFIVLFISNVVNLLYDPDPHAEQTKGYKINIEEHIPTEVNNTEE
QIDIESLIAQANIAKGKDLTKKCISCHTFEKGGANRVGPNLWHIVGNKKAHLGDSFNYSK
AMLSKGGTWEYQDLFQFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLKSLE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggacggattccacttaaacaagatatttacagccattttatttgcatcatttatagta
ctgtttattagcaatgtggtaaatttattatacgatcccgatccacatgctgaacagaca
aaaggttataaaataaatatagaagaacatattccaacagaagtcaataatactgaagaa
caaatcgacattgaatctctaatagcacaagctaatattgcaaaaggcaaagatctcaca
aaaaagtgcatatcttgtcatacttttgaaaaaggaggagcaaatagagtaggaccaaat
ttatggcacattgtaggcaacaaaaaagcacatctaggggacagcttcaattactcgaaa
gcaatgctaagcaagggcggcacatgggaatatcaagatctatttcagtttttaacaaaa
cctcaagcttatattaaaggtacacgcatggcatttgctggtatttcaaagccccaagac
gtagcagacttaattgcatacttgaaatctttggaataa

DBGET integrated database retrieval system