KEGG   Ehrlichia chaffeensis Arkansas: ECH_0350Help
Entry
ECH_0350          CDS       T00328                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECH_0350 (folK)
Enzymes [BR:ech01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ECH_0350 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(339625..340134)
Genome map
AA seq 169 aa AA seqDB search
MFNDVVMLALGSNCGNMLAYIKSAINMLPLHNKNYSYLYKTPALLPENAADHWDTPYLNM
VVSGYTNLSSSAMLERIKSIEKMLGRINHQRWAPRPIDIDIILWGNKVVDSQTLSIPHQQ
MHCRDFVLVPLCDIYARFIHPVLQIPIYEMLLSLNNINLIKQNSHVLQQ
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacgatgttgtaatgttagcgttaggaagtaactgcggcaacatgctggcatat
attaaatccgcaattaatatgttacctttacataacaaaaattattcttatctttataaa
actccagctttattaccagaaaatgcagctgatcattgggatacaccttatttaaatatg
gtagtatcaggatatacaaacttgtcttcatctgccatgttagaaagaattaaatctata
gaaaaaatgcttggtagaattaatcatcaacgttgggcacctagacctatagatattgac
attatattgtggggaaacaaagttgtggattcacaaacgttatctatacctcatcaacaa
atgcattgtagagattttgtattagtaccattatgtgatatctatgctaggttcattcat
ccagtattacaaataccaatatatgaaatgcttctaagtctaaataatattaacctaata
aaacaaaattcacatgtattgcaacagtaa

DBGET integrated database retrieval system