KEGG   Ehrlichia chaffeensis Arkansas: ECH_0646Help
Entry
ECH_0646          CDS       T00328                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECH_0646 (tpiA)
   01230 Biosynthesis of amino acids
    ECH_0646 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECH_0646 (tpiA)
   00051 Fructose and mannose metabolism
    ECH_0646 (tpiA)
   00562 Inositol phosphate metabolism
    ECH_0646 (tpiA)
Enzymes [BR:ech01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECH_0646 (tpiA)
Exosome [BR:ech04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECH_0646 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECH_0646 (tpiA)
  Exosomal proteins of melanoma cells
   ECH_0646 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650242..650964)
Genome map
AA seq 240 aa AA seqDB search
MSLLIVANWKMYGDFLTFSSFTKELSANLVNVKADVEVVLCPPFIACSKIVDCAPNIKLG
AQNCFYESEGKYTGEVSAKMLYSCGCSYVIVGHYERRSIFYESDYCVQLKAKSAIDAGLI
PIICIGETLLDRENGMLKNALLDQCYNSFPKHGEFVIAYEPVWAIGSNTIPSIDMITESL
DIIRSYDSKSNIIYGGAVNQSNIKDVIAINQLSGVLVGSASLKVSSFCDIIYGAVNVRQN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgctcatcgttgctaattggaagatgtatggtgactttcttactttttcctct
tttacaaaagaattaagtgctaatttagttaatgtaaaggctgatgtagaagtggtattg
tgtccaccttttattgcatgttctaagatagttgattgtgctcccaatattaaacttggt
gcacagaactgtttttatgaatctgaagggaaatatactggggaagttagtgctaaaatg
ttgtatagttgtggttgcagttatgtaatagtaggtcactatgagagaagaagcatattt
tatgaatctgattattgtgtacagttgaaggcaaaatctgcaatagatgcagggttaatt
ccaattatttgtattggggaaactttgttagatagagaaaatggtatgttaaaaaatgct
ttattagatcagtgttataattctttccctaaacatggtgagtttgttatagcttatgag
cctgtatgggcaataggaagtaatactattccttctattgatatgataactgaatcttta
gatattataaggtcgtatgatagtaaatctaatattatatatggtggtgcagtgaatcag
agtaacataaaggatgttattgctataaatcaattgtctggtgtattggttggtagtgcc
agtttaaaggtaagtagtttttgcgatataatatatggtgctgtaaatgtgaggcaaaat
taa

DBGET integrated database retrieval system