KEGG   Ehrlichia chaffeensis Arkansas: ECH_0826Help
Entry
ECH_0826          CDS       T00328                                 

Definition
(GenBank) HIT family protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIT DcpS_C
Motif
Other DBs
NCBI-ProteinID: ABD44733
UniProt: Q2GG11
Position
842543..842893
Genome map
AA seq 116 aa AA seqDB search
MQDNTSYDNNNVFAKILRKELPCNVVYEDEFVLAFHDIHPQAPIHILVIPKGEYISFDDF
SDSSADIRHFFSIVKKITHQFQLEKTGYRIVTNHGKQGGQIVPHFHVHILGGKQLP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataatacttcttatgacaataacaacgtttttgcaaagattttaagaaaagaa
cttccatgtaacgtagtatatgaagatgagtttgtattagcatttcatgacatacatcct
caagctcctatacacattctagttattcccaaaggcgagtatatatcatttgatgatttc
agtgattcttcagcagacattagacattttttttctattgtaaagaagattacccaccaa
ttccaattagaaaaaactggatatagaattgttacaaatcatggaaaacaaggaggacaa
attgttccacatttccatgtgcatattttaggcggaaaacagctaccataa

DBGET integrated database retrieval system