KEGG   Ehrlichia chaffeensis Arkansas: ECH_0838Help
Entry
ECH_0838          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 YtpI
Motif
Other DBs
NCBI-ProteinID: ABD44925
UniProt: Q2GFZ9
Position
complement(856700..857917)
Genome map
AA seq 405 aa AA seqDB search
MCFYPILNWIIGVLVLICGSNFQIAYAIVNSYVGEDLNLNVAQTALAASIHMWCFSIFQL
FTGSILDCYNEKKVLSISVILTSIGTFLFAHADYTICFFVSQIFLALGASFGFVGAGYIS
YKFFSPLKSGIMFGLVQTVYSLSSLLMEYIYTYLTLSGLSWRDIIRYIEYAEIIILIFTL
FLKNSTKSTYLVKSGNTNIIKLLLQVFKHIVEILQVRNIWLFTVVGSSMFGVFLSIAILW
GQKLLMAMNLSGYYAGVIHSVIWIGFAIGCPLVNAISNILENRKHVLMGFCLLQCISLSL
LLYSSNLYFLCFLVFIFGCASGGHMLNFSIGTDVVDKDKVGTVCSLINGLMCIVGGVIMF
LIGLALEYQNKYDIIHISFFMPVLIFLSFILLFFCRDTFCRIRVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttttatcctattttaaattggattataggggtattagtacttatttgtgggagt
aattttcaaatagcttatgctatagtaaattcatatgtaggtgaagatttaaatttaaat
gttgcacaaactgcattagcggcatcaattcatatgtggtgtttttccatttttcagcta
tttactggttcaatattagattgttataatgaaaaaaaagtactatcaatatctgttata
ttaacatctataggaacttttttatttgctcatgctgattatactatttgtttttttgta
tcgcagatttttttagcattaggggcatcttttggctttgtaggtgcaggttatattagt
tataagtttttttcccctttaaagtcagggattatgtttggactagttcaaacagtgtat
agtttatcttctttattaatggaatatatctatacatatttgactttgtcagggttatct
tggagagatatcattaggtatatagaatatgctgaaattattatactcatttttacgttg
tttctaaaaaatagtacgaagtcaacatatctagtaaaaagtgggaatacaaatatcata
aaattattattacaagtgtttaaacatattgttgaaatactacaggtaagaaacatatgg
ttatttacggtagttggtagttctatgtttggagttttcttatcaatagctatattgtgg
ggacaaaaattattaatggctatgaatttgagtggctattatgctggtgttatacattct
gttatatggataggttttgctataggttgtcctttagtaaatgcaatttctaatatattg
gaaaatagaaaacatgtgcttatgggtttttgtttgttacaatgtattagtcttagtttg
ttattatatagtagtaatttatactttttgtgttttttagtatttatatttggatgtgca
tctggtggacatatgttgaatttttctattggtacagatgttgtggataaagataaagta
gggactgtttgttcacttattaatggactgatgtgtattgtaggtggtgtcattatgttt
ttaattggacttgctttggaatatcaaaataaatatgatataatacacataagctttttt
atgccagtgcttatttttctatcgtttattttgttatttttttgtcgtgatactttctgt
aggattagggttttgtaa

DBGET integrated database retrieval system