KEGG   Ehrlichia chaffeensis Arkansas: ECH_0845Help
Entry
ECH_0845          CDS       T00328                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02010  
iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ABC transporters
Module
Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:ech00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECH_0845
Enzymes [BR:ech01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.30  Fe3+-transporting ATPase
     ECH_0845
Transporters [BR:ech02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    ECH_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(862510..863532)
Genome map
AA seq 340 aa AA seqDB search
MVGLQLNNVCYKYKKGQFLLHNISMSCKQGEVICLLGPSGCGKSTILKLIAGLENLHCGS
IYINNKILASSNFCMPTEERNVGLIFQHPSLFPHQTVIENVMFAVRNLPKIQKFNVALDI
LKSINMVAYKDMYPDMLSGGQQQLITIARAIAQKPEVILLDEPFSSLDTALRINIRRHVL
SLLKAKGITVLLVTHDPEEALEVADIIYVMRDGYIVQHGTPYEIYYSPKDHMLAQFFGEI
NRFVCTVKDSCIELPIGKIPAQSFTNGEKVVVCIRPEAIISDSDKGVKAVVKQIKFFNNM
ICVCVGDCLCWMRFANVVLPQVGDTIFILLDLNKILLFKV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtaggtttacagttaaacaatgtctgttataaatataaaaaaggtcaatttttattg
cataatattagtatgagttgtaaacaaggagaagttatttgtcttcttggcccttctggg
tgtggtaagtctacaatactaaagttaattgctgggttggagaatttacattgtggttcc
atatatataaataataaaattttagctagcagtaacttttgtatgccaactgaagaacgt
aatgttggcttaatatttcagcatccttctttatttccacatcagactgttattgaaaat
gtaatgtttgctgttagaaatttgcctaaaatacagaagtttaatgttgcactagatata
ttaaaatctattaatatggtagcatataaagatatgtatcctgatatgctttctggagga
caacaacagttaattacaattgctagagcaattgctcagaaaccagaagtgatattgtta
gatgaaccattttctagtcttgatacagcattacggattaatattagaaggcatgtgtta
tcattattaaaagctaagggaattactgtattacttgttactcatgatccggaggaagca
ttagaagttgcagatataatatatgttatgcgtgatggatatatagttcagcatggtacc
ccatatgagatatattatagtcccaaagatcatatgttagcacagtttttcggtgagatt
aatcgttttgtttgtacagtgaaggattcttgtatagaattaccgatagggaaaatacca
gcacaatcttttactaatggagaaaaagtagtagtttgtataagacctgaggcaataatt
tctgattcagataaaggagtaaaagctgtagtaaaacagataaaattttttaataatatg
atctgtgtttgtgtaggtgattgtttgtgttggatgaggtttgctaatgtagttttacca
caagttggtgatactatatttatcttgcttgacttaaataaaattttattatttaaggta
tag

DBGET integrated database retrieval system