KEGG   Ehrlichia chaffeensis Arkansas: ECH_0849Help
Entry
ECH_0849          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
867657..870866
Genome map
AA seq 1069 aa AA seqDB search
MQGGWTFNNTQRKFYKDILKHIQKNQVVNPTIRQPIGYLSHKFDQWLFAVQNTPHEKCVI
ITEECLNTIILNSIDFQSFALVSEKLDADFQEQCDAQGILFLSGLRLQLTKHIAKQVRDS
GVGAIPLCDIERLLNQNTPLPINFNPADIDCYSDFVDSILNASNKDVLYEEAQKVLNIVA
PLTPYILIMRGLSHAIIKRTNPHSEINHDEQLVIEAKTSILLHTTAATQLTRETQVSLAN
EAFAHEHPVQDKIIRAANYFNTYLSSTISWTYIGSILSVFVTRMYAGYASSRAESDIQSA
LLQARHNVTFNHTRIYQPDLNINPNHTTGNNTVVYAPRHPSEQFPEHQGVLNGAPSYATT
LMSTLQLTWTLPNIILGQKKRTFILKHLKKYRPTQEDRRNDNKFLATVIFRWFGNVIIQP
VDCVDSELKDAFFRWTIFRFFTPLAPIEEPLKMRGLYARLTRKCYRNQERELQISNRIMN
SASLAILAFEYLDVALGFPFPICSAILKGTRIASVVLPVLVNRLRDNITYNPRFRRFILA
NMLRTGSSPLVLTGFDLIGNSIRYVSLLTAFDVMATVNVDAVSSSILYEADVLEQHIMII
EDTVENIIFTNRGSLALLAPSMEIRFTDSRNRITISEILEEDEEELQTRRHATREHNSTE
IIYRLRGARRVLHQEVPGTMRDGIPLLSYRRRHSSSTIEEPIIGPEERAAYFYEQNILHP
NRNIETRTQPGTHHVASKNLLNSDIYLEAQNPVILISHTRRSSVDISQEQPVVFVEQQES
DVDDQPETPELRAAYFYQQNILHPRRNTETSIPPGVSPARAPTGMLNESIYLEEQEGERL
TSYRRCSSITLTEEECELQQVIVEQQDPDRGPHPTDSDIINLRATYFYQQNILHPRRDTE
TSTTPGVYHVRAPVNMLNADIYLEEQNEGQLTSYTRHSGTTSSNQGRSRRSGRSALNEPL
PDSQIRQAFFSQLHPRRRSGDPLQDIIPESMMQAEILLDPEEDPPLLFGRNIPTCSITEI
ITEESDTSTQQAAGATATPIGGADDDDNTLPSSTLHVSSATHHGAPLSR
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgcaagggggatggacatttaacaatactcaaaggaaattttacaaagacatactgaag
catatacaaaaaaatcaagttgtgaatccaactattagacaaccaataggttatctttca
cataagtttgatcagtggctttttgctgtccaaaatactcctcatgaaaagtgtgttata
atcactgaggaatgccttaatacaatcattttaaattcaatagactttcaaagctttgca
ttagtatcagaaaaacttgatgcagattttcaagagcaatgtgatgcacaaggaatacta
tttttatctggtcttcgcttacaattaacaaaacacattgctaaacaagtaagggatagt
ggtgtaggagcaatacctttatgtgatattgaaaggctgttaaaccaaaatacaccatta
ccaattaatttcaatccagcagacattgactgttatagtgatttcgtagatagcatatta
aatgccagtaataaagacgttctatatgaagaagcacaaaaagtacttaatatagtagct
ccactaactccttatattctaataatgagaggtttatcacatgcaattataaaacgtaca
aaccctcactcagaaataaatcatgatgaacagcttgttatagaagctaaaacatctatt
ttattacatacaacagctgcaacacaacttacaagagaaactcaagtatctctagctaat
gaagcatttgctcatgaacatccagtacaagataaaattattagagcagctaattatttt
aatacataccttagtagtaccatttcatggacatatattggtagtatactctcagtattc
gtaacacgtatgtatgctggatatgctagcagtagagcagaatcagatatacaatctgca
ttattacaagcacgtcataatgttacttttaatcatacccgcatctatcagcctgattta
aatattaacccaaatcataccaccggaaataacacagttgtttatgcccccagacaccct
tctgaacaattcccagaacaccaaggcgttctaaatggggctccttcttatgcaacaact
ctaatgtctacactacagcttacttggacactgcctaatataattctaggacaaaaaaaa
agaacgtttattctcaagcatttaaaaaaatatagacctacacaagaagatcgaagaaat
gataataagttcttagctacagtaatatttcgctggttcggaaatgtcattatacagcct
gttgattgcgtagattctgaacttaaagatgcctttttcagatggactatctttaggttc
tttacaccacttgcaccaattgaagaaccattaaaaatgcgaggcctttatgctcgtctt
accaggaaatgttaccgaaatcaagaaagagagctccagataagtaacaggattatgaat
agtgctagtttagcaatactggcctttgaatatttagatgtagcgctcggatttccgttc
ccaatatgttcagcaatattaaaaggaacaagaattgcgtcagtggtacttccagtatta
gtaaacagattacgtgataatataacttataacccaagattcagaaggtttatacttgca
aacatgttaagaacaggatcttcacctcttgtattaacaggttttgacctaatcggtaat
tcaatacgttacgtgagtttattaacagcatttgatgtaatggcaaccgtaaatgttgat
gcagtatcatctagtattttatacgaagctgatgtattagaacaacacatcatgattatt
gaagatacagtagaaaatattatattcaccaatagaggaagcctagcattacttgcccca
agcatggaaataagatttactgactcaagaaatcgaataactattagtgaaatcttagaa
gaagatgaagaggagttacaaactcgtcgacatgcaactagagagcacaacagtacagaa
ataatctacaggttaaggggagcaagacgtgtattacatcaggaagtacctggtacaatg
cgggacggaatacctctattatcctataggagacgtcacagcagcagcactatagaagaa
ccaataataggccctgaggaaagagcagcatatttttatgaacaaaatatattgcatcca
aacaggaatattgaaacaagaacacaaccaggtacacatcatgtggcatcaaaaaatcta
ctgaattcagacatatatcttgaagcacaaaatccagtaatattaatttctcatacaaga
cgttctagtgtagacatttcacaagaacaacctgtagtgtttgtagaacaacaagagtca
gatgtagatgatcagcctgaaactcctgaactaagagcagcatatttctatcaacaaaat
atactgcatccaagaaggaatactgaaacaagcataccaccaggtgtatctcctgcgcgg
gcaccaacaggtatgctgaatgaaagtatatatcttgaagaacaagaaggagaaaggtta
acatcttacagaagatgttctagtatcacacttacagaagaagaatgtgaattacaacaa
gtaattgtagaacaacaagatccagatagaggtcctcatcctacagatagtgacatcatt
aatctaagagcaacatatttctatcaacaaaatatactgcatccaaggagggatactgaa
acaagcacaacaccaggtgtatatcatgtgcgggcaccagtaaatatgctgaatgcagat
atatatcttgaagaacaaaatgaaggacagttaacatcttatacaagacattccggcact
acatcttctaatcaaggaagatcaagaagatcaggtagaagtgccttaaatgaaccatta
ccagactctcagataagacaagcctttttctctcaactacatccaagaagaagatcaggt
gatccattacaggatataataccagaaagtatgatgcaagcagagatacttctagatcca
gaagaggatcctccattactatttggtagaaacattcctacatgcagtattacagaaatc
ataactgaagaaagtgatacctcaacacagcaagcagctggagctactgcaactcctatc
ggaggcgcagatgatgatgataatacattaccaagttcaacacttcacgtctcttctgct
acacaccacggtgctcctttatcaagataa

DBGET integrated database retrieval system