KEGG   Ehrlichia chaffeensis Arkansas: ECH_0857Help
Entry
ECH_0857          CDS       T00328                                 

Gene name
nth
Definition
(GenBank) endonuclease III
  KO
K10773  
endonuclease III [EC:4.2.99.18]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ECH_0857 (nth)
Enzymes [BR:ech01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     ECH_0857 (nth)
DNA repair and recombination proteins [BR:ech03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     ECH_0857 (nth)
 Prokaryotic Type
     ECH_0857 (nth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(877676..878308)
Genome map
AA seq 210 aa AA seqDB search
MNRRNINLLFTKFKEHNPHPRIELKYTNSFTLLIAIVLSARTTDVSVNKITDKLFEVADT
PRKMLDLGEKGLKNYINTIGLYNSKSKNIIALSGIIINQHNSNVPLDFNTLVALPGVGRK
SANVFLNTWLNLPTVAVDTHVFRVSNRIGLVKESNVLKTEDALLNVIPKKWLLYAHHWLV
LHGRYVCKSRKPLCSQCVVQDLCEYESKSL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaaggaatataaatttactctttactaaatttaaggagcataatcctcacccc
agaatagaactgaagtatactaatagttttactttactaatagcaatagttttatctgca
cgtactactgatgttagtgtaaataagattacagataaactatttgaagttgctgatact
ccaagaaaaatgttagatcttggagaaaaaggactaaaaaattatataaatacaatagga
ttatataattctaaatctaagaatattattgcacttagcggaattattataaatcaacac
aatagtaatgtacctttagattttaatactcttgttgcattaccgggtgtaggtagaaaa
agtgctaatgtttttttaaatacatggttaaatttaccaactgttgctgttgatactcat
gtgtttagagtaagtaataggataggattagttaaggaaagtaatgtattaaagacagag
gacgcgttgttaaatgtaataccaaaaaagtggttattatatgcgcatcattggttagta
ttacatggtaggtatgtgtgtaagtcaagaaagccattgtgtagtcagtgtgttgttcaa
gatttatgtgaatatgaaagtaaaagtttatga

DBGET integrated database retrieval system