KEGG   Ehrlichia chaffeensis Arkansas: ECH_0871Help
Entry
ECH_0871          CDS       T00328                                 

Definition
(GenBank) putative twitching motility protein PilT
  KO
K02669  
twitching motility protein PilT
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
Secretion system [BR:ech02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   ECH_0871
  Type IVa pilus homolog protein
   ECH_0871
Bacterial motility proteins [BR:ech02035]
 Pilus system
  Twitching motility proteins
   ECH_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
890319..891332
Genome map
AA seq 337 aa AA seqDB search
MLFFNQLIQSSIGYSSDYLYLTPNNPPAIRRYNNIEFLQIKSLSTQEIEEIIKSILKAEE
YQKCMTQGFSNTTLAFDDSYQLHIHILYTATQSFKIIVNIIQNELIVTPEFEKELHRIIS
ICSKGLLLFTGNICNDNTALFILNQINDNQKKHVLIFSNDTIPVPKSNKALISIHNLPQA
EPTFIKNQAADIVCFSNFNNANLVRTAITCINMGLLVIAFTDTISCLCALENIAILFPHK
KSILKILSTHLIAIITQVFIRVSSDNLYLYDIIECDTTVQQYIREDNLSEIKNLGMIKKI
NQLIEKHQVHYHDVANILKNLSDTNQPYTEPNHNDLF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttattttttaatcaattaatacaatcttctatagggtattcttctgattatctatac
ttaacaccaaataacccaccagctatcagacgatacaacaatatagaatttcttcaaata
aaaagtttgtctacacaagagatagaagaaattataaaatcaatattaaaagcagaagag
tatcaaaaatgcatgacacaaggattttctaatactacacttgcttttgatgattcttac
caattacatatacatattttatatactgctacccagtcttttaaaattatagttaatatt
atacaaaatgaactcatagtaacaccagagtttgaaaaagaattacacagaataattagt
atatgttcaaaaggattactattatttactggaaacatatgtaatgacaacaccgcatta
tttatattgaatcaaattaatgataaccaaaaaaagcacgtactaatcttcagtaatgat
acaatacctgtcccaaaatccaacaaagcattaattagtatacacaatttaccacaagct
gaacctacatttattaaaaaccaagcagcagatattgtatgtttcagtaattttaataat
gctaatttagtacgcacagccattacatgtatcaatatgggtctactcgttatagcattt
actgacacaatttcatgcttatgcgcactagaaaatattgcaatattatttccacacaaa
aaatctattttaaaaatactatcaacacatttaatagctataataacacaagtctttatt
agagtatcgtctgataacttatatttatatgacataatagaatgcgataccacagtacaa
caatacattagagaagataatttatcagaaatcaaaaacttaggtatgattaaaaaaata
aaccagcttatagaaaaacatcaagtacattaccatgatgtagcaaatatattaaaaaac
ctatcagatactaaccaaccatacactgagcctaatcacaatgatcttttttaa

DBGET integrated database retrieval system