KEGG   Ehrlichia chaffeensis Arkansas: ECH_0873Help
Entry
ECH_0873          CDS       T00328                                 

Definition
(GenBank) Coq7 family protein
  KO
K06134  
ubiquinone biosynthesis monooxygenase Coq7 [EC:1.14.13.-]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECH_0873
Enzymes [BR:ech01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     ECH_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(893383..893895)
Genome map
AA seq 170 aa AA seqDB search
MLQKDNLLQQAIRVNHAGEYGAVCIYSGQELIFRKMSVGEKILEMKKQEQKHFRYFDSVM
KDKKIRPTVFLPVWHVMGVMLGITTALMGEDAAMACTVAVEDVISDHYQDQIAMLDEGEL
KDKVIQFRNEELEHHDTAMCYNSGNAANYSILSFFIKKACKAAICLSKVM
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaaaagataatctattgcaacaagctattcgagtaaatcatgctggagagtat
ggagcagtgtgtatatattctggtcaagaattgatttttcgtaaaatgtctgttggtgag
aaaattcttgaaatgaagaaacaagaacagaagcattttcgttattttgattctgtaatg
aaagataaaaaaatacgtcctacagtttttttaccagtatggcatgttatgggagttatg
ttaggtattacaacggctttaatgggtgaggatgcagctatggcttgtactgttgctgtg
gaagatgtaataagtgatcattatcaagatcaaatagcaatgttggatgaaggtgaatta
aaagataaggttattcagtttcgtaatgaagagctggaacatcatgatactgctatgtgt
tataattctggtaatgctgctaactatagtatcttgtctttttttataaaaaaggcatgc
aaagctgctatctgtctttctaaagttatgtga

DBGET integrated database retrieval system